KEGG   Myxococcus xanthus: MXAN_0103Help
Entry
MXAN_0103         CDS       T00366                                 

Definition
(GenBank) hypothetical protein
Organism
mxa  Myxococcus xanthus
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
118283..118753
Genome map
AA seq 156 aa AA seqDB search
MGALGFPRHPLEHGVARVTRVAAQLTGLVCDGVCLARLGQSLVRGRTFMMKQGKRVPGLK
WVIAAFILAGCRGAEGEVPTETESRLSLKEGQVLGPACTGEQKQCPEGLSCASFNLGSGP
EIRCVQSPEICDLFKCSSGECVVLESHPIQVRCSGS
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
ttgggggcccttggatttccgaggcaccccttggagcatggcgtcgcccgcgtcacgcgg
gtggctgctcagctgacgggcctcgtctgcgatggcgtatgtcttgctcggctcggacag
tcactggttcgtgggaggacattcatgatgaagcaaggcaagcgtgttccggggctgaag
tgggtcatcgccgcgttcatcctggcgggctgtcgtggtgccgagggcgaggtgcccacg
gagaccgagtccaggctgtcgttgaaggagggccaggtgcttggcccggcgtgtaccggg
gagcagaagcaatgccccgagggcctctcctgcgcctcgttcaacctgggctcgggcccc
gaaatccgctgcgtccagtccccggaaatctgtgacttgttcaagtgcagcagcggcgag
tgtgtggtgctggagagccatccaatccaggttcgttgcagcggctcctga

DBGET integrated database retrieval system