KEGG   Myxococcus xanthus: MXAN_0106Help
Entry
MXAN_0106         CDS       T00366                                 

Definition
(GenBank) FG-GAP repeat domain protein
Organism
mxa  Myxococcus xanthus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
121721..123724
Genome map
AA seq 667 aa AA seqDB search
MQRISAVALTSLLAVSLCACDDPVEPGDPDSGTPDAGQPDGGDAGAGDGGTFLSEVPLWQ
VEHDPAHATGCFGRSIALGDVNGDGQKDLVVAAPPCLSLTRDPGRVSLFAGEAPYFSTQG
VTAVMDWRNANSRTNGTRMTVSTGDVDGDDSADVLVSGQYGALVFKGQTDLASVFTEPAF
VVPGGGVYNNAVFADVNGDGLDDVVSVKGLVLSVFLATPGAPGGPFTLVERTEPLYTGAV
HRAGDVDGDGAQDLLLLDSMGDVYSLLHGCKAGSPGPCDGGLAAQPFWTVDSRTLSLFPD
VNGDGVPERFTGPGGGTVRLHLSEAGGGYASAPTWTAMGDPVFANFGATITAVGDVDGDG
QRQDFVAGSEGRLYFYSPAEGVSSALSPVWSWPRADALPQGYEGFHRFTVIAPGDLNGDR
FDDLVAGVAPSPGLVDGPGGRVVIFGGGRVPAEPTTAPHLPPVAGCGLTLDPVHGKPDLS
VDADVLARTLYVERRTFAADSCEMLEGCVPAPGERRLLRFSTSIQNLGAAAASVPNMDER
PDLYVWDECHGHEHLTNFAQYVLRDAQGNEVVEGRKQGFYLVDYQRQCDDAAPFHFPLDR
MSISAGWADIYVADIPCQWIDITDLTDGTYSLRVGVDEQDIIEEADVLPNEAILNVRIQG
DSVTVVP
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgcattagcgctgtcgccctgacctcgctgctggccgtttcactctgcgcatgt
gatgaccccgtggagccaggggaccctgattcgggaacgccggatgccgggcagcccgac
ggaggcgacgcgggagccggggacggaggcacgttcctctccgaggtgccgctctggcag
gtggagcacgaccccgcgcacgccaccggctgcttcggccgctccatcgcgctgggcgac
gtgaatggcgatggccagaaggacctggtcgtcgccgcgcctccgtgcctctcgctcacg
agagaccccggccgggtgtcgctcttcgcgggcgaggcgccgtacttctccacgcagggc
gtgacggcggtgatggactggcgcaacgcgaactcgcggaccaatggcacccggatgacg
gtgagcacgggcgacgtggacggggatgactccgcggacgtgctcgtctccggccagtac
ggcgcgctcgtcttcaagggccagacggacctggccagcgtcttcaccgagcccgcgttc
gtggtgcccggcggcggcgtgtacaacaacgccgtcttcgcggacgtcaacggggacggc
ctggatgacgtggtcagcgtgaaggggctggtgctgtccgtcttcctggccacgcccggc
gcgccgggagggcccttcaccctggtggagcgcacggagccgctctacaccggcgctgtc
catcgcgcgggcgacgtggacggggatggcgcacaggacctcctgctattggattcgatg
ggagacgtctattcgctgctccatggctgcaaggccggcagccccgggccgtgtgacggc
gggctcgcggcgcaacccttctggacggtggacagccggacgctgagcctcttcccggac
gtgaatggggacggggtgccagagcgcttcacggggccgggcggtggcacggtgcggctc
cacctgtcggaggcgggcggcggctatgcctccgcgcccacgtggaccgccatgggtgac
cccgtcttcgcgaacttcggtgccaccatcaccgcggtaggggacgtggacggggatggg
cagcgccaggacttcgtcgcgggctccgaggggcggctgtacttctattcgccggcggag
ggggtgtcctcggcgctgagccccgtgtggtcctggccgcgggcggacgccctgccgcag
gggtacgaaggcttccaccgcttcaccgtcatcgcgccgggggacctgaacggcgaccga
ttcgatgacctggtggcgggcgttgcgccttcgccagggctcgtcgacgggccggggggc
cgggtcgtcatcttcggcggtggccgggtgcccgcggagccgactacggcgccgcacctg
ccgcccgtggcgggctgtggcctgacgctggacccggtgcacggcaagccggacctctcc
gtggacgcggacgtgctggcccgcacgctgtacgtggagcgccgcaccttcgccgcggac
tcctgtgagatgttggagggctgcgtgcccgcgcccggtgagcggcgcctgctgcgcttc
agcacctccatccagaacctgggcgcggcggcggcctcggtgcccaacatggacgagcgg
ccggacctctacgtctgggacgagtgccacggccacgaacacctcaccaacttcgcccag
tacgtgctgcgggacgcgcagggcaacgaggtcgtggagggccgcaagcagggcttctat
ctggtcgactaccagcgccagtgcgatgacgcggcgcccttccacttcccgctggaccga
atgagcatctccgccggctgggcggacatctacgtcgccgacatcccctgccagtggatt
gacatcaccgacctgacggacggcacgtactccctgcgcgtgggcgtggatgagcaggac
atcatcgaggaagcggacgtgctccccaacgaggccatcctgaacgtccgcatccagggc
gattccgtgaccgtggtcccgtaa

DBGET integrated database retrieval system