KEGG   Myxococcus xanthus: MXAN_0109Help
Entry
MXAN_0109         CDS       T00366                                 

Definition
(GenBank) hypothetical protein
Organism
mxa  Myxococcus xanthus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rick_17kDa_Anti
Motif
Other DBs
NCBI-ProteinID: ABF88612
UniProt: Q1DG31
Position
complement(126904..127737)
Genome map
AA seq 277 aa AA seqDB search
MSHARHPETRGGHLSTVRVEAPAPRAHLRDTPRVAMLNVPSHRRPITACTLLLGCLLSAA
SHAAATDAPLRDTPPPETRSRYLDTPAAPSPERAAVPTYIEPEDVPLPKGAWVAHGGLSL
LPVAGVWGASRVGGDTRVGATAAETAAGMLLGAIPSRLLFFRPAAPSPGRWMELETVAFG
GGFVLTPPLTALGTWGLGELAFGESHHPDRAYLGALGGAALGTLLGVIVHEALVKLSKPS
ARLKSGRQLVGLGFIGVGATLGYQWAGGGPRPDGHTR
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgtctcacgcaagacaccccgagacgcgcggcgggcacctctccaccgtgagggtggaa
gcccccgccccgcgtgcgcaccttcgggacacaccgcgtgtcgccatgctcaacgtgccc
tcacaccgacgtcccatcaccgcgtgcacactgctgctgggctgcctgctgtccgccgcg
agtcacgcggcggccacggacgcaccgctgcgcgacacgccacctcctgaaacacgttcc
aggtacctggacacgcccgccgccccgtccccggaaagagcagccgtgcccacgtacatc
gaaccggaggacgtcccgctgcccaagggcgcatgggtggcgcacggcgggctctcgctg
cttcccgtagccggcgtctggggcgccagccgcgtgggcggggacacccgcgtgggtgcc
accgcggcggagacggcggcgggaatgctcctgggcgccatcccctcgcggctcctcttc
ttccgtcccgcggcgcccagcccggggcggtggatggaattggagaccgtggccttcggc
ggcggcttcgtgctgacaccaccgctgacggcgctcggaacgtggggcctgggcgagctc
gcctttggcgagagtcaccatccggaccgcgcctacctgggcgcgctcggcggcgcggcc
ctgggcacgctgctgggcgtcatcgtccacgaagccctggtgaagctgtccaagcccagc
gcccgcttgaagagcggccgtcagctcgtcggcctgggattcatcggcgtgggcgcgacg
ttgggctatcaatgggcaggcggcggacctcgcccagacggacacacgcgatag

DBGET integrated database retrieval system