KEGG   Myxococcus xanthus: MXAN_0110Help
Entry
MXAN_0110         CDS       T00366                                 

Gene name
cls
Definition
(GenBank) cardiolipin synthase
  KO
K06131  
cardiolipin synthase A/B [EC:2.7.8.-]
Organism
mxa  Myxococcus xanthus
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    MXAN_0110 (cls)
Enzymes [BR:mxa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.-  
     MXAN_0110 (cls)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
127779..129026
Genome map
AA seq 415 aa AA seqDB search
MKLAWLVPVVLIAAGCPAPNHRHDLRLRALPGTSPEARSLAFFQSLGVALVPGHRVELVE
NGFIFDAIEEEILAARTSIHIISYIWRPGEPSDRLVRALAARRPGVACRVLVDPLGSVNF
EAVIPALAASGCDARYFRPIQGDFVALDAVRLRARNHRKMVVRDGEVGITGGWGIWKSWM
GNAQSAESWRDMNIRVEGPAVREMQVAFAQNWQEAGGDFLPATDFPEPRYAGDARAGFVA
STDNRFLSDARRMTLLTIAAAQERLWIANSYFIPSDAISDMLLEKVKQGVDVRVLVPGRH
HDVGPVNAAQRASYARLLEGGVRIWEYELSMMHSKTMLVDDSLSVVGSTNMDPLALTTLE
ECSVVVEDVALAAQLAASFEKDLRHSREIHWSGWKRRGLLQKLGERLPWFIGSFL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
gtgaagctcgcctggctcgtgcccgtggtgttgattgccgccgggtgtcccgctcccaat
caccggcatgacctgcgcctgcgcgcgttgccggggaccagtccggaggcgcgctcgctc
gcgttcttccagtcattgggcgtggcgctggtgccagggcaccgcgtggagttggtggag
aacggcttcatcttcgacgccatcgaggaggagattctcgccgcgcgcaccagcatccac
atcatcagctacatctggcgccccggtgagccgtcggaccggctggtgcgggcgctggcg
gcgcggcggcccggggtggcgtgccgcgtgctcgtggacccattgggcagcgtcaacttc
gaggcggtgattcccgcgctggcggccagcggctgtgacgcgcgctacttccggcccatc
caaggtgacttcgtggccttggacgcggttcgcctgagggcgcggaaccaccggaagatg
gtggtgagggatggcgaggtgggcatcaccggcggctggggcatctggaagagctggatg
gggaatgcgcagagcgcggagtcctggcgcgacatgaacatccgcgtggagggcccggcc
gtgcgagagatgcaggtcgccttcgcgcagaactggcaggaggcgggtggagacttcctg
ccggcgacggacttcccggagcctcgctacgcgggggatgcgcgcgccggcttcgtggcc
agcacggacaaccgcttcctgtcggacgcgcggcggatgacgctgctcaccatcgcggcg
gcgcaggagcggctctggattgcgaactcctacttcattccctccgacgccatcagtgac
atgctgctggagaaggtgaagcaaggcgtggacgtgcgggtgctggtgcccgggcggcac
catgacgtcgggcccgtgaacgcggcgcagcgggcgtcctatgcgcgcttgctggagggc
ggcgtgcgcatctgggagtacgagctgtcgatgatgcattccaagacgatgctcgtggat
gactccctgtccgtcgtgggctccaccaacatggacccgctggcgttgacgacgttggag
gagtgctcggtggtggtggaggacgtggcgctggcggcgcagctcgccgcatcctttgag
aaggatttacgccactcgcgggagattcactggagcgggtggaagcggcgcgggctcttg
cagaagctgggcgagcggctgccgtggttcatcggcagttttctctga

DBGET integrated database retrieval system