KEGG   Myxococcus xanthus: MXAN_0111Help
Entry
MXAN_0111         CDS       T00366                                 

Definition
(GenBank) hypothetical protein
Organism
mxa  Myxococcus xanthus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
129078..130409
Genome map
AA seq 443 aa AA seqDB search
MARARPTSPRCPRCNAPFALTQGQELYTCGYCNASIDTRGEKAPLPSYEAPPVPESEERG
GIPVGVIQLAAIGGVVLALIALVVGFITWTTASESTGGPIPGGPGPAPIVVARPPGVEKA
STFQWDTTSVPLVVDLNGDGTDDFVGRIRRLMPNTGGTDIRSMAAAFDGKSLGLLWETGL
EGSISELSGTVHFVHQGGRVVMSSPDAVSILDPQTGKQLGRVALSDKPRNLCIPRGDTES
VWVDVSDGQNLLLNTKTAAARPAIEPPPSCAPFKWGPRMCPPQLVRRSPIPCERPRDLPD
VPGFSAQHVYKLNDLNVVLGERSPGSRVPMAAVFQQGQKVPLWHGNVADMDPKMVKERVV
EVLAFSEDALVMVYELKEGGAQLIRRDMRTGSVSWDVPIPNSKSGSGASDIKLHGGRVYV
PHWVWLDVFDAKTGNLIGTLGKW
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcgcacgcccgacctcgcctcgttgccctcgttgtaacgcgcccttcgccctc
acacagggacaggagctgtacacctgcggttactgcaatgcctccatcgacacgcggggc
gagaaggcaccgctcccctcctatgaggccccgcccgtaccagaatccgaggagcgtggg
ggcatcccggtcggggtgattcaactggcggccatcggcggcgtcgttctggcactcatc
gcgctggtcgtgggcttcatcacctggacgactgcctccgagtccaccggtggtcccatc
ccgggcgggccggggccggctcccatcgtcgtggcgcggccacccggggtggagaaggca
tcgacgtttcaatgggacacgacgagcgttcccctggtggtggacctcaacggggacggg
acggacgacttcgtcgggcgcatccgtcggctcatgcccaacaccggtgggacggacatc
cgctcgatggccgccgcgttcgatgggaagtcgctcggattgctctgggagacgggcctc
gaggggtcaatctcggagctcagcggcacggtgcacttcgttcatcagggcgggcgcgtg
gtgatgagttcgcctgacgcggtgagcatcctcgacccgcagacgggcaagcagctcgga
cgggtggcgctctcggacaagcctcgcaacctctgcatcccacggggcgacaccgagtcc
gtctgggtcgatgtttcggatgggcagaacctcctgctcaacacgaaaacggcggccgct
cggcccgccatcgagccgcccccctcctgcgcgccgttcaaatggggcccccggatgtgt
cccccccagttggtgaggaggagtcccatcccctgtgaacgcccgcgcgacctgccggac
gttcccgggttttcggctcagcatgtctacaagctgaatgacctgaacgtcgtcctgggt
gagcggagtcctgggagccgcgtgcccatggcggcggtgttccagcagggccagaaggtc
ccgttgtggcatggcaacgtcgccgacatggaccccaagatggtgaaggagcgcgtggtg
gaggtcctcgccttctccgaggacgcactcgtcatggtctacgagttgaaggagggggga
gcgcagctcattcgcagagacatgcggacggggagcgtcagttgggacgtccctattccc
aactccaagagcggctcgggggcgtccgacatcaagctgcacggtgggcgcgtctacgtt
ccgcattgggtgtggctggatgtcttcgacgcgaagacgggcaacctgattggcaccctg
ggcaagtggtga

DBGET integrated database retrieval system