KEGG   Myxococcus xanthus: MXAN_0112Help
Entry
MXAN_0112         CDS       T00366                                 

Definition
(GenBank) acetyltransferase, GNAT family
Organism
mxa  Myxococcus xanthus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
130502..131032
Genome map
AA seq 176 aa AA seqDB search
MDTRHVVERALVREARPEDDAVVGELLVDAFLTQYAKKLPEVVYGDERKRELRDVASRRK
AATVLVAELDGQVVGTVALFKPGAPGSEAWLPNAADLRGLATAVSHHGTGLAQPLLDAAE
ARAREWGVDAVCLHVRRGAEGVGRMYQRRGFVREPVGDLDLPTVFLEGYVLRFKKD
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atggacacccggcatgtcgtagagcgggccctcgttcgcgaggcgcggcccgaggatgac
gcggtggtgggggagttgttggtggatgccttcctcacccagtacgcgaagaagctcccg
gaagtcgtctatggcgacgagcgcaagcgcgagctgcgggacgtcgcgtcccggcgcaag
gcggccaccgtgctggtggccgagttggacggtcaggtggtgggcaccgtcgcgctcttc
aagcccggtgcccccggctccgaggcctggctgcccaacgccgccgacctgcgcggcctg
gccaccgccgtgagtcaccatggcaccgggctggcccagcccctcctggacgccgccgag
gcccgggcgcgcgagtggggcgtggacgccgtgtgcctccacgtccgcaggggcgcggag
ggcgtggggcgcatgtaccagcggcgcggcttcgtgcgcgaacccgtgggcgacctggac
ctgcccacggtgttcctcgaaggctacgtgctgcgcttcaagaaggactga

DBGET integrated database retrieval system