KEGG   Myxococcus xanthus: MXAN_0113Help
Entry
MXAN_0113         CDS       T00366                                 

Definition
(GenBank) hypothetical protein
Organism
mxa  Myxococcus xanthus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(131035..132717)
Genome map
AA seq 560 aa AA seqDB search
MEGMRDMSQNGSSAESARVRWLVVGAFSPSPSGRRFPLTVNTFGDELTRAASGLRVTVAD
RLGAGDTRTVELSFDRLRAFSYADVITRVPELRALQHLHESLSTSDPLRTLTPEEAATRV
ATVTGPGRLPDAVAEALRAASTPPAPTAPTAPTESGEDLVETLLSRADASTPAAASRAVD
AFLRAINPRVPATPAPVVTPEAATRQTARDLVEQALLLTAKDLLGAEPVAHLESAWRGLK
WLLDQVPASSGISVEVLDVARAGLLDAVQGALGAEPFERPDAVFIMDATDDVALLGKLAA
MGERAQLPVVAAVSAPLLGVAQAELAVALEEEREHVPEAWTELRQDESARWLCAVINRAV
VASEGRGAARRVSFTSPALAVAAMLAASFRDTSAFARIMGQQGGLKAPAMWELPTGRDTG
LSIPTEHFLPIRAQARLEERGILGLGSGRNADAVLLAAAPMVFGGGYAVPLPAQLLTGRI
VRFATWVRDQLPAGTGGDDVDAIFSQAAEVFLFRGATENGQLRGQLVATDNGRGVHVTAT
VRPEHAGTRFQLAFTLPLRG
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
gtggaggggatgcgggacatgagccagaacggaagcagtgccgagagcgcacgcgtgcgc
tggctggtggtgggtgccttctccccgtccccctcgggccggcgcttcccgctcacggtg
aacaccttcggggatgagctcacgcgcgccgccagcgggctccgcgtcaccgtggcggac
cgactgggcgcgggtgacacgcgcaccgtcgagctgtccttcgaccggctgcgcgccttc
agctacgcggacgtcatcacccgcgtcccggagctgcgcgccttgcagcacctgcacgaa
tcgctgtccacgtccgatccgctgcgcacgctgacgcccgaggaggccgccacgcgcgtg
gccaccgtcaccggcccaggccgccttccggacgcggtggccgaggccctgcgcgcggcc
tccacgccgcccgctcccacggcgccgaccgcgcccaccgaatccggcgaggacctggtg
gagacgctcctcagtcgcgccgacgcgagcacgcccgccgccgcgtcccgggcggtggat
gccttcctgcgcgccatcaatccacgcgtgcccgccacgcccgcgcccgtcgtcacgccg
gaggccgccacccggcagacggcccgggacctggtggagcaagcgctgctcctcacggcg
aaggacctgctcggcgccgagcccgtggcccacctggagtccgcgtggcgcggcctcaag
tggctgctggaccaggtgcccgcgtcctcgggcatctccgtggaggtgctggacgtggcg
cgcgccgggctgctggacgccgtgcagggcgcgctaggcgccgagcccttcgagcgcccc
gacgccgtcttcatcatggatgccaccgacgacgtcgccctcctgggcaagctcgcggcg
atgggcgagcgcgcgcagctcccggtggtggccgccgtgtccgcgccgctcctgggcgtg
gcgcaggcggagctggccgtggcgctggaggaggagcgcgagcatgtccccgaggcctgg
acggagctgcgccaggacgagtccgcgcgctggctgtgcgccgtcatcaaccgcgcggtg
gtggccagcgagggtcgcggcgcggcccggcgcgtgagcttcaccagccccgcgctggcg
gtggcggcgatgctggcggccagcttccgggacaccagcgccttcgcgcgcatcatgggc
cagcagggcggcctgaaggcgcccgccatgtgggagctgcccaccggccgcgataccggg
ctgagcattcccaccgagcacttcctccccatccgggcgcaggcgcggctggaggagcgc
ggcatcctgggcctgggcagcgggcgcaacgcggacgcggtgctgctggccgccgcgccc
atggtgttcggcggaggctacgcggtgccgctgcccgcgcagttgctcaccgggcgcatc
gtccgcttcgccacctgggtgcgggaccagttgcccgcgggcaccggcggcgacgacgtg
gacgccatcttctcgcaggccgcggaggtgttcctcttccggggcgccacggagaacgga
caactgcgcggccagttggtggccacggacaacggccgcggggtgcacgtcaccgccacc
gtccgcccggagcacgcgggcacgcgcttccagctcgccttcaccctgccactgcgcggc
tga

DBGET integrated database retrieval system