KEGG   Myxococcus xanthus: MXAN_0114Help
Entry
MXAN_0114         CDS       T00366                                 

Definition
(GenBank) transglycosylase SLT domain protein
Organism
mxa  Myxococcus xanthus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
132926..134035
Genome map
AA seq 369 aa AA seqDB search
MGRLQQPSNPPRRNFPMRLSPLSGSASSAVRSPAQDVSVSRPSASLSGPSGASAQKPSLG
RIGMQQDGFDLGGGKAESLGKLLEGALAIINTLAQLQQAMQAGGAAGGAQGASYGQGISG
AQGAQGASSSKCFLDSSFSPASARGGRPPVELNPSAQGPSPFMNEPVEGLTSAPAAGGPA
PAPAPVSDIEGAPVGGIGAAPSVGASTGAGGASLGGNLPPALEKLRPALESAAAKTGVPV
EMLAAQVWAESRGKVDASSTNGGNGMTDTGLMQVNPNTFKGLQDKYPELQGKNLSDPETN
ILAGACYMKDMKAQFGNWDLALRAYNSGPNGVDKSNPHAIPAGLGSADYVRNVNQFASTL
ASGQGALPA
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
gtgggtcgcctacagcagccctccaaccctccccgaaggaacttccccatgcgcctctct
cctctcagcggctccgcctcctccgccgtccgctccccggcccaggatgtctccgtctcc
cggccttccgcgtcgctgtctggtccctcgggtgcctcggcccagaagccgtcgctgggg
cgcatcgggatgcagcaggatggcttcgacctgggcggcggcaaggccgagtccctgggc
aagctgctcgagggggccctggcgattatcaacacgctggcccagctccagcaggccatg
caggcgggcggcgcggcgggtggcgcgcagggcgcttcgtacggccagggcatttccggt
gctcaaggcgcccagggcgcgtcctcgtccaagtgcttcttggacagctccttctcgcct
gcgtcggcccgcggtggccgtcctcccgtggagctgaaccccagcgcccagggcccgtct
ccgttcatgaatgagccggtggagggcctcacgtcggcgcctgccgctggtggccccgcg
cccgcgcccgctccggtgagtgacatcgagggtgcgccggtgggcggcatcggcgcggcg
ccctcggtgggcgcgagcacgggtgccggcggcgcgagcctgggcggcaacctgcctccg
gcgctggagaagctgcgtccggcgctcgagtccgcggcggccaagacgggcgtgccggtg
gagatgctggccgcgcaggtgtgggcggagtcgcgcggcaaggtggacgcctcgtccacc
aacggcggcaacggcatgacggacacggggttgatgcaggtgaaccccaacaccttcaag
gggctgcaggacaagtaccccgagttgcagggcaagaacctgtctgacccggagacgaac
atcctcgcgggcgcctgctacatgaaggacatgaaggcgcagttcgggaactgggacctg
gccctgcgcgcctacaactccggtccgaacggcgtggacaagagcaacccgcatgcgatt
cccgcgggcctgggcagtgcggactacgtgcgcaacgtgaatcagttcgccagcaccctg
gcttccggtcagggcgcgctgccggcgtag

DBGET integrated database retrieval system