KEGG   Myxococcus xanthus: MXAN_0118Help
Entry
MXAN_0118         CDS       T00366                                 

Definition
(GenBank) hypothetical protein
Organism
mxa  Myxococcus xanthus
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(139252..139824)
Genome map
AA seq 190 aa AA seqDB search
MMAKKYFQLADNVSIPGRWELGHPGDARGHEVDDPWMFREGHPVEVSQRFTVPIEEPGKA
LDFSLAGFSTPVVSASVANIFLEMAPKDVQLLPVDIHGPLDPYFILVATRLIRCIDDAAS
EEVLHWRPEDGRPEKVGQYRDVYGMRVDLAQVGNAQVFRTWGWSIALIVSEDIKQALERA
KATGVKFTPV
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgatggccaagaagtatttccagctcgccgacaacgtttccattccgggccgttgggag
ttgggccacccgggagatgcgcgaggtcacgaagtagacgacccttggatgttccgggag
ggccatccagtggaggtgagccagcgattcacggttcctatcgaggagccgggcaaggcc
ctcgatttttctctcgcgggcttcagcactcccgtggtcagcgccagcgtggccaacatc
ttcctggagatggctcccaaggacgtgcagctcctccccgtggacatccatggccccctg
gacccgtacttcatcctggtggccacgaggctcattcgctgcattgacgacgcagcatcg
gaagaggtgctccactggcgcccggaggatgggcggcccgagaaggtggggcagtaccgg
gatgtctacggcatgcgcgtcgacctcgcccaggtgggcaacgcccaggtgttccgcacc
tggggctggtccatcgccctcatcgtctccgaggacatcaagcaggctttggagcgtgcg
aaggcgaccggcgtgaagttcacaccggtgtag

DBGET integrated database retrieval system