KEGG   Myxococcus xanthus: MXAN_0129Help
Entry
MXAN_0129         CDS       T00366                                 

Definition
(GenBank) hypothetical protein
Organism
mxa  Myxococcus xanthus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
150949..151809
Genome map
AA seq 286 aa AA seqDB search
MLVAMTWRRCLSLAACIWIVIPVHAARADGDFERHVAEAVRLYDDLEYERALEQLDRARG
SLRGSRDRVTLALHRGIISADLGRWQAARDEFRSALLLEPEARLPLRVSPKVGREFEAQR
ALAKAELARRRRDSPTREAARIEQAEVETESVADASSALPAALTPTEQATASSPVEVQAW
TATSSASWRRIGGRQVPLASLVLLGAGIAATGTGTVFGVSSRGQLADAREARFHEHLVEH
RGRAQRSARTANVLFGTAGVAAAGALVTWLLLGERDEAVTQQGGAR
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgcttgttgccatgacctggaggcggtgcctgtcgctcgccgcatgcatatggattgtc
attccagtgcatgcggccagagctgatggcgactttgagcgtcatgtcgcggaggccgtg
cgcctctatgatgatctcgaatacgagcgagccctcgagcagctggatcgtgcccgaggg
agcctccgagggtcgcgcgatcgagtgacgcttgcattgcatcgcggcatcatcagcgcg
gacctcgggcggtggcaggcggcgcgtgacgagttccgttcagcccttctgcttgagcca
gaggcacgccttcccttgcgcgtttcccccaaagtcgggcgggagttcgaggcccagcgt
gcactcgcgaaagcggaactggcgcgtagacgaagggactcgcccacgcgggaagcagcc
cgcatcgagcaggccgaggtggaaacggagtcggttgcggacgcctcttcagcgctgccc
gccgcgctgacgcctaccgaacaggccacggcttcgagcccagtggaggtccaagcctgg
acagcaacgtcgagcgcttcctggaggcgcatcggggggcggcaggtgccgcttgccagt
ctggtgctgctgggggctggcattgcggcaaccggtacgggaaccgtcttcggcgtctct
tcccgagggcagctcgcggacgctcgggaggcgaggttccacgagcatctcgtggaacat
cgcggccgtgcgcagcgcagtgcgagaacggccaacgtcctctttggtacggccggggtt
gcggcagcgggtgccctggtgacctggctcttgttgggagagcgggacgaggccgtcacg
cagcaagggggggcacgatga

DBGET integrated database retrieval system