KEGG   Myxococcus xanthus: MXAN_0145Help
Entry
MXAN_0145         CDS       T00366                                 

Definition
(GenBank) scramblase family protein-like protein
Organism
mxa  Myxococcus xanthus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(177208..178092)
Genome map
AA seq 294 aa AA seqDB search
MSPPTPRVKRMSDKRPLADTTELELDWRGRAPRKPEAPSSAALEPLSEVEVPSGAGKGLP
GDPRHMSIELRQSVQGMMETPALRMRQMREGLEIFFGAQTRNRYEVCDDTGRVALYVEEE
ARGFGAMLRRTFSPFYKARMECMTLGGIVALVVERPWSILLTKADILAWDGRLMARIQQR
FTLLGRHLDIVTPGGAVIATVKGPLFRPWTFRIFQNDVEIAVVRKRWSGFLQESFSAADT
FTLDFQPQCTDFRLRQLVLAVALLVDLTYFENNSPRAALGPGLDLFDALMFWKK
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
ttgtccccgcccacgcctagagtgaagcggatgagcgacaagcgccccctggcggacacg
accgagttggagctggactggcgtggccgcgccccccgcaagccggaggcgccctccagc
gcggccttggaaccgctttccgaggtcgaggtgccgtccggcgcgggcaaggggctcccg
ggcgacccgcgccacatgagcatcgagttgcgccagtcggtgcaggggatgatggagacg
cccgcgctgcgcatgcggcagatgcgcgaggggctggagattttcttcggcgcccagacg
cgcaaccgctacgaggtgtgcgacgacacggggcgcgtcgcgctctacgtggaggaggag
gcccgtggcttcggcgccatgctccggcggaccttctcgcccttctacaaggcccggatg
gagtgcatgacgctgggcggcatcgtggcgctcgtggtggagcgtccctggagcatcctc
ctcacgaaggcggacatcctggcctgggacggccggctgatggcgcgcatccagcagcgc
ttcaccctgttgggacgccacctggacatcgtcacgcccggcggcgccgtcatcgccacc
gtgaagggcccgctcttcagaccctggaccttccgtatcttccagaatgacgtggaaata
gccgtggtccgcaagcgctggagtggcttcctccaggagagcttctccgccgcggacacc
ttcaccctcgacttccagccccagtgcaccgacttccggctgcggcagttggtgctggcc
gtcgccctgctcgtcgacctgacgtacttcgagaacaacagcccccgcgccgccctgggc
ccggggctggacctgttcgacgcgttgatgttctggaagaagtag

DBGET integrated database retrieval system