KEGG   Myxococcus xanthus: MXAN_0149Help
Entry
MXAN_0149         CDS       T00366                                 

Definition
(GenBank) Ser/Thr protein phosphatase family protein
  KO
K03547  
DNA repair protein SbcD/Mre11
Organism
mxa  Myxococcus xanthus
Brite
DNA repair and recombination proteins [BR:mxa03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     MXAN_0149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(185456..186709)
Genome map
AA seq 417 aa AA seqDB search
MPFKFVHAADLHLDTPFRGVATQGPLLGRFQDSTFRALTRITEVCLRERVAFLLLAGDLF
DVKDRSVRARLALRRELGRLDAAGISTFIVHGNHDPLSGDTGALGLPPSVKVFGPDWEEV
EVKREGRRLCRVQGISYPDVEVRDDLSARFRRTGDGFSVGLLHANLGRAEGHANYAPCTT
AGLGSRGLDYWALGHVHTRAEHMLPGGGVAVYPGNPQGRHANETGPRGCMLVEVEDGGMR
RRFIPVDGVRWHKLEVPLSGVSTLDGLLATVMEGVEARCAPELDGHAVRLTLTGRGPLHR
ELARPGALAQLEVDLREQLARSHPPVLLESLRDSSRPEVDLEAVCAAGGFARTLLDEVGF
LAEDPAALARLWEEEAMGALSQRLKRLGVDALEAPRAEWVVQAGLHGVESLHEEETS
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgcccttcaagttcgttcatgccgccgacctgcacctggacacgcctttccggggcgtc
gcgacccaggggccgctcctgggacgcttccaggattcgacgttccgagcgctcacgcgc
atcacggaggtgtgcctgcgagaacgggtggccttcctgctgctcgccggagacctcttc
gatgtgaaggaccgctcggtgcgcgcgcggctggcgctgcggcgcgagttgggccggctg
gacgctgcgggcatctccaccttcatcgtccacggcaaccatgacccgctgagcggagac
accggcgcgctggggcttccgccgtcggtgaaggtgttcggcccggactgggaagaagtg
gaggtgaagcgcgagggccggagactgtgccgcgtgcagggcatctcctatccggacgtg
gaggtgcgcgacgacctctccgcgcgcttccgccgcaccggggatggcttcagcgtggga
ctgctgcacgccaacctgggccgcgcggagggccacgccaactacgcgccctgcaccacc
gcgggtctgggctcgcgcgggctggattactgggcgctgggccacgtccacacgcgcgcc
gagcacatgctccccggcggcggcgtggcggtgtaccccggcaacccgcagggccggcac
gcgaacgaaaccggcccgcgcggttgcatgttggtggaggtggaggacggcggcatgcgg
cggcgcttcatccccgtggacggggtgcgctggcacaagctggaggttccgctgtccggc
gtcagcacgctggacggactgctggccacggtgatggagggcgtggaggctcgctgcgcg
cccgagctggacggccacgcggtgcgactcaccctcaccggaagaggtccgctgcaccgc
gagctggcccgtcccggcgcgctggcacagttggaggtggacctgcgcgaacagctcgcg
aggagtcacccaccagtgctgttggagtcgctgcgggacagcagccggccggaggtggac
ctggaggcggtgtgcgcggcgggcggcttcgcgcgcacgctgctggacgaggtgggcttc
ctcgcggaggacccggcggcgctggcgcggttgtgggaagaggaggccatgggcgcgctg
agccagcggctgaagcggctgggcgtggacgcgctggaggcgcctcgcgcggagtgggtg
gtgcaggccgggctgcacggcgtggagtcgctgcatgaggaggagacgtcatga

DBGET integrated database retrieval system