KEGG   Myxococcus xanthus: MXAN_0152Help
Entry
MXAN_0152         CDS       T00366                                 

Definition
(GenBank) hypothetical protein
Organism
mxa  Myxococcus xanthus
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(188295..189032)
Genome map
AA seq 245 aa AA seqDB search
MSGGALYQESLRALRRLGLPEVSERDVLAALEAAQPGPLSLFYEAGAEAGLPREALMARG
AGLFLSFSAGNLADDLIDGECTYHDPPIRVGPCVQFILQNLAFATLCGAPAQLPGTVLEE
AVRTLAVAAGPQALEVRASDWTAPLFRQVAEGIAGQQWAAYLRVLWAGTVLEPRAAAAGR
ALGVAAHVAEDIRTRDVRFTSMPGADRHAVVAWARAAAQALRRLDLRCLDAALRRIEPML
PEGES
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcggagccctgtaccaggagtcgctgcgcgcgcttcgccggctgggcttgccg
gaggtgtcggagcgggacgtgctcgcggcgctggaggcggcgcagcccggccccctgtcc
ctcttctacgaggcgggcgcggaggccggtctgccgcgcgaggccctgatggcgcgcggc
gccgggctcttcctcagcttcagcgcgggcaacctcgccgacgacctcatcgacggtgag
tgcacgtaccacgacccacccatccgcgtggggccgtgcgtgcagttcatcctccagaac
ctggccttcgccacgctgtgcggcgcgccggcgcaactgccgggcacggtgctggaagag
gcggtccgcaccctggcggtggccgccggcccgcaggcgctggaggtgcgcgccagcgac
tggacggcgccgttgttccgccaggtcgcggagggcatcgccggccagcagtgggccgcg
tacctgcgcgtgttgtgggcgggcacggtgctggagccccgcgcggcggcggcgggccgg
gcactgggcgtggccgcgcacgtggcggaggacatccgcacgcgggacgtgcgcttcacc
agcatgcccggggcggaccgtcacgcggtggtggcctgggcgcgcgccgccgcgcaggcg
ctgcgccgactggacctgcgctgcctggacgcggcgctgcgccgcatcgaaccgatgctg
ccagagggggagtcatga

DBGET integrated database retrieval system