KEGG   Myxococcus xanthus: MXAN_0158Help
Entry
MXAN_0158         CDS       T00366                                 

Definition
(GenBank) hydrolase, alpha/beta fold family
Organism
mxa  Myxococcus xanthus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
193489..194274
Genome map
AA seq 261 aa AA seqDB search
MPTTSAKDGTSLHYRVVGEGPRTVILVHGWMVSGAVWDALVERLDLTGLRLVIPDMRGSG
QSGRPDGGFSLESLAHDVLAVADAVDARRFTLVGHSMGGQLVKWVAAEVPARVEGLVLLN
TVPAAGLPLPPDAAGLFRTSADSREKKQTILGLACKQLSPEALEALVKDSMGVSPAAIEH
VFDAWTAGGFADKLASITAPTLVLATDDAFLPAAFLREAVVSRIRGARLSYLPGPGHYPQ
VERPAETAALVSAFLAGSQPA
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgcccacgacttcagcgaaagacgggacttcgctccactaccgtgtcgtgggtgagggt
ccgcgcacggtcatcctggtccacggttggatggtatcaggcgcggtctgggatgcgctg
gtggagcgcctggacctgacggggctgcggctggtgattccggacatgcggggctcgggt
cagtcgggccggccggacggaggcttcagtctggagtcgctggcgcacgacgtgctggcc
gtggcggacgccgtggacgcgcggcgcttcacgctggtggggcacagcatgggcggccag
ctggtgaagtgggtggccgcggaagtgccggcgcgcgtggaggggctggtgctcctcaac
acggtgcccgccgcgggtcttccgctgcctccggatgcggcggggctgttccgcacgtcg
gcggacagccgcgagaagaagcagaccatcctcggactcgcgtgcaagcagttgtcgccg
gaggccctggaggcgttggtgaaggactcgatgggcgtcagcccggcggccatcgagcac
gtcttcgacgcgtggacggcgggtggcttcgccgacaagctggcctcgattacggcgccc
acgctggtgttggccacggacgacgccttcctgccggcggccttcctgcgggaggcggtg
gtgtcgaggattcgcggcgcgcgcctgtcgtaccttcccggccccggtcattacccacag
gtggagcgcccggcggagacggcggcgctggtgtccgccttcctcgccggctcccagccg
gcctga

DBGET integrated database retrieval system