KEGG   Myxococcus xanthus: MXAN_0166Help
Entry
MXAN_0166         CDS       T00366                                 

Gene name
kdpC
Definition
(GenBank) K+-transporting ATPase, C subunit
  KO
K01548  
K+-transporting ATPase ATPase C chain [EC:3.6.3.12]
Organism
mxa  Myxococcus xanthus
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MXAN_0166 (kdpC)
Enzymes [BR:mxa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.12  K+-transporting ATPase
     MXAN_0166 (kdpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
201586..202221
Genome map
AA seq 211 aa AA seqDB search
MFSTFLTALRTCVVTMVLTGLLYPLAVTGLAQLLFPGEANGSWVKDGRGRVVGSALIGQG
FTRAGYFHPRPSAAGAGYDGAASSGSNLGPTSLKLKERAAAELERLRRENPDAAGPVPAE
LVTTSASGLDPHLSPEAARWQAARVARARGVALERVLDVVDARVEGRTFGVLGEPRVNVL
LLNLALDRRFGPLPDAAPGVGGRASPGQGAP
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgttctccacattcctcacggccctgcgcacgtgcgtcgtcacgatggtgctcacgggg
ctgctgtacccgctggccgtcaccgggcttgcgcagctcctctttccgggggaggccaat
ggctcgtgggtgaaggacggccggggccgcgtggtgggcagcgcgctcatcggccagggc
ttcacccgggcggggtacttccatccgcgtccttccgccgctggcgcgggctacgacggc
gcggcgtcctcgggcagcaacctggggcccacgtcgctgaagctgaaggaacgcgcggcg
gccgagctggagcgcctgcgccgggagaatccggatgcagcggggcccgttcccgccgag
ttggtgacgacgtccgcgtctgggttggacccccacctgtcgccggaggcggcgcgctgg
caggcggcgcgggtggcacgggcccgcggcgtggcgctggagcgggtgctggacgtggtg
gacgcgcgggtggaggggcggaccttcggcgtgctgggcgagccgcgcgtcaacgtcctg
ctgttgaacctcgcgttggacaggcgcttcgggccgcttccggacgcggcgccgggcgtg
gggggcagggcctcgccgggccagggcgcaccttga

DBGET integrated database retrieval system