KEGG   Myxococcus xanthus: MXAN_0168Help
Entry
MXAN_0168         CDS       T00366                                 

Definition
(GenBank) sensory box histidine kinase
Organism
mxa  Myxococcus xanthus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
203476..205323
Genome map
AA seq 615 aa AA seqDB search
MTLRARLLLAQAPLALALLLVGVVAVVTLSQLGRSGPRVLQDNYRSVLAAQEMMAQLERM
DSGALFIIAGERQRGLTQQAAQRARLESQLRVQEGNVTEPAEDAATLRLRTSWRRYQEAY
DGFLAQSSPEGAREAYFGVLEPAFQEVTGAARAILDLNQDAMVRKSEALQRQSARVNTVM
VAAVMVAFVVGLFASQSLTHRALRPVSVLSQAVRRLGEGDYAARAVVEGQDEIAQVGRDF
NAMAEALQQYRRSSLGELLQAQAASQAAIDSLPDPVVVFGADGGLLNVNRAAEDVLRLSL
EAGGDMLGQVVPEARAVLERVREHVLTGRGAYQPRGYEEAVRAPLPDGDRWLLARGSPVH
GESGEVVGATVILQDVTRLRRFDELKNDLVATVAHEFRTPLTSLRMALHLVTEGVVGPVT
EKQADLLFAAREDSERLQGIVDDLLDLSRIQAGQLQLEIRRVPAEELVDAALDAQRMAAE
ERGVQVSKQVGLDVEPVDVDPERLGLVLGNLVGNAVKHTPPGGEVEVHVWQESHGVRFEV
RDTGEGIALEQQARIFEKFYRAPGAPAGGAGLGLSIAKDIVQAHGGDIGVVSTPGQGSTF
WFTLPRREESGPASV
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgcgagcccggttgttgttggcgcaggcacccctggccctggcgctgttgttg
gtgggcgtggtggccgtggtgacgttgtcccaactggggcgttctgggcctcgggtgctt
caggacaactaccgcagtgtgctggccgcgcaggagatgatggcgcagttggagcgcatg
gacagcggggcgctcttcatcatcgcgggtgagcggcagcgcgggctgacgcagcaggcg
gcgcagcgcgcgcgcttggagtcgcagttgcgggtgcaggaaggcaacgtcaccgagccc
gccgaggatgcggcgacgctccggttgcgcacgtcctggcggcgttaccaggaggcctat
gacgggttcctcgcccagtcgtcgccggagggggcgcgggaggcgtacttcggtgttctc
gagccggccttccaggaggtgaccggagcggcccgggccatcctggacctgaaccaggac
gccatggtgcgcaagagcgaggcgttgcagcggcagagcgcgcgggtgaacacggtgatg
gtggcggcggtgatggtggccttcgtggtggggttgttcgcgtcgcagtcgctgacgcac
cgggcgctccgtccggtgtcggtgctgtcacaggcggtgcggcgcctgggcgagggcgac
tacgcggcgcgcgcggtggtggagggacaggacgaaatcgcgcaggtggggcgggacttc
aacgccatggcggaggcgcttcagcagtaccggcgcagcagcctgggtgagttgctccag
gcgcaggcggcatcacaggcggccatcgacagcctgccggacccggtggtggtgttcggc
gcggacggagggctgctcaacgtcaaccgcgcggcggaggacgtgctgcggctgtcgctc
gaagcgggcggggacatgctggggcaggtggtgccggaggcgcgcgcggtgctggagcgg
gtgcgtgagcacgtgttgacggggcgaggggcgtatcagccgcgcgggtacgaagaggcg
gtgcgggcgccgctcccggacggggaccggtggctgctggctcggggaagtccggtgcat
ggcgagtcaggggaggtggtgggggccacggtgattctccaggacgtgacgcggctgcgg
cgcttcgacgagctgaagaacgacctggtggccacggtggcgcacgagttccgcacgccg
ctcacgtcgctgcgcatggcgctgcacctggtgacggagggcgtggtggggccggtgacg
gagaagcaggcggacctgttgttcgcggcgcgcgaggactccgagcggctgcagggcatc
gtggatgacctgctggacctgtcgcgcatccaggcggggcagcttcagttggagattcgc
cgggtgccggcggaggaactggtggacgcggcgctggacgctcagcggatggcggcggag
gagcgcggggtccaggtgtcgaagcaggtggggctggacgtggagccggtggacgtggac
ccggagcggctggggttggtgctggggaacctggtgggcaacgcggtgaagcacacgccc
ccgggaggcgaggtggaggtgcacgtgtggcaggaatcgcacggggtgcgcttcgaggtg
cgcgacacgggggaggggattgccttggagcaacaggcgcgcatcttcgagaagttctac
cgggcacccggcgcgcctgcgggaggcgcggggctggggctgtccatcgcgaaggacatc
gtccaggcacacggcggggacattggcgtggtgagtacgcccggccagggaagcacgttc
tggttcacgctgccccggcgggaagagtccgggccggcgagcgtgtga

DBGET integrated database retrieval system