KEGG   Myxococcus xanthus: MXAN_0172Help
Entry
MXAN_0172         CDS       T00366                                 

Definition
(GenBank) sigma-54 dependent DNA-binding response regulator
  KO
K11384  
two-component system, NtrC family, response regulator AlgB
Organism
mxa  Myxococcus xanthus
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MXAN_0172
Two-component system [BR:mxa02022]
 NtrC family
  KinB-AlgB [MD:M00505]
   MXAN_0172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(207019..208380)
Genome map
AA seq 453 aa AA seqDB search
MDIGERPMRVLVVDDERNIRHTLRVCLEGFGCEVREAATPEAALAALAQGPADLAFVDLR
LGTASGMELLPRLLAESPHLDVVLITAYATFDTAVEAMRRGARDYLPKPFTPAQIRHAVE
KARRHQELASQLENLEGQLSQAVPEATLETASPAMHAAIGLLTRAAASDAAVLLRGESGT
GKGVLARALHSMSARRRRPFVTVNCPTLSEQLLASELFGHVRGAFTGAVKDQPGRVEAAE
GGTLFLDEIAEMSPGLQAQLLRFLQEKQFERLGEGRTRKADVRVVAATNRDLEKDVAEGR
FREDLLYRLNVIEVKLPSLRERPEDLLSLARRFVSFFARAAQRPPPELSPATEKMLLAYG
WPGNVRELRNAMERALIVWPAEVLEPQAFPDRIAAAGSPVMTLGGPHTLEDIEREHVLRV
MASAPTLDEAARVLGIDASTLWRKRKKYESGEG
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggacattggtgagcgccccatgcgggtgctggtggtggacgacgagcggaacatccgc
cacaccctgcgcgtgtgcctggagggcttcggctgtgaggtccgcgaggcggccaccccc
gaggccgcgctggccgcgctggcgcaaggccccgccgacctggccttcgtcgacctgcgg
ctcggcacggccagcggaatggagctgttgccgcgcctcctggccgagtcgccccacctg
gacgtcgtgctcatcaccgcctacgccacgttcgacacggcggtggaggcgatgcgacgc
ggggcacgggactatctgcccaagcccttcacgcccgcgcagattcgccacgcggtggag
aaggcgcggcggcaccaggagctggcatcgcagttggagaacctggaggggcagctttcc
caggcggtgccggaggccacgttggagacagcctcgcccgcgatgcacgcggccatcggg
ctgttgacgcgcgcggcggcgtccgacgcggcggtgctgctgcggggagagagtggcacc
ggcaagggggtgctcgcccgcgcgctgcattcgatgagtgctcggcggcgccggcctttc
gtcaccgtcaactgtcccacgctgtccgagcaactgctggccagcgagctgttcggccac
gtgcgcggcgcgttcaccggcgcggtgaaggaccagccaggacgcgtggaggcggcggaa
gggggcacgctgttcctggatgaaatcgcggagatgagtccggggctccaggcgcaactg
ctgcgcttcctccaggagaagcagttcgaacggctgggcgagggacgcacgcgcaaggcg
gacgtgcgggtggtggcggcgacgaatcgggacctggagaaggacgtggccgaggggcgc
ttccgggaggacctgctctaccggctgaacgtcatcgaggtgaagctgccgtcgctgcga
gagcggccggaggacctgctttcgctggcccggcgcttcgtctccttcttcgctcgcgcg
gcgcagcgcccaccgccggagctgtcgcccgcgacggagaagatgctgttggcctatggg
tggccgggcaacgtgcgcgagctgcggaatgcaatggagcgagcgctcatcgtctggccc
gcggaggtgctggagccgcaggcgttccccgaccgcatcgccgcggcggggagtccggtg
atgaccctgggcgggccgcacacgttggaggacatcgagcgcgagcacgtgctgcgcgtc
atggcctcggcgcccacgttggatgaggcagcgcgggtgctgggcatcgacgcgtccacg
ctgtggcggaagcggaagaagtacgagtcgggcgagggctga

DBGET integrated database retrieval system