KEGG   Myxococcus xanthus: MXAN_0176Help
Entry
MXAN_0176         CDS       T00366                                 

Definition
(GenBank) sensory box histidine kinase
Organism
mxa  Myxococcus xanthus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
213061..214989
Genome map
AA seq 642 aa AA seqDB search
MLEVFVFAADTSTHVDGVVLAVAIAGGRAGRAGRAGRGLGGRRFRRGLVWPGGASGGGTA
RGQHGHQEQHREARGRHVAEAYRFRMASGLGVGAPSAVAAEQGGPFHALGGRRIFPPEMS
RQRGRGAPMSKAHIYEEGRSGWGAPGAAEARHPSGPDFAPALLRLGQALQAALIVDAHGR
VLWMDDALTHATGPQGEPFQGRSVAEVLARLPWLAQAMQPALQGKAGVHEEPGLTAFVLP
MFDEQGTLLGACARLQLPESSMGQVAEGGLTRHAPESLAHMNSVLRATFDSIAEGVIVVD
LNKRVTAFNKRFLDIWGLTEEMMVDRDAERVLVRAAGGVKHPESFTSRIRERFEPSEEVD
VETVELLDGRILERKSLPQRMGGAIIGRVWSYREVTAERQAEAERERLLREAQEAIRVRD
DFLSIAAHELKTPLTPLKLHLQMLRQHGAEGDGASARHVDKSLMQVSRLTGLVNDLLDTS
RIQEGRLTLKHGPVVLQELAHDVVSEMRLSSAHHRVEYEAPEAPLVVLGDADRLAQVLVN
LMENAFKYSPSGGTVRVRVAREDRHAHVSVQDEGIGIPRDQQEHLFERFFRARNAPISGF
GGLGLGLYICGDIVERHGGRLWVESVLGHGSTFRFTVPLAST
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
gtgctggaggtattcgtgttcgccgccgacacctccacccacgtggatggggtcgttctt
gctgtagccatagccggagggcgcgctgggcgcgctgggcgcgctgggcgtggcctcggg
ggccgccgcttccgtcgcgggctcgtctggccgggtggcgccagcggtggaggcacagcc
cgtggccagcacgggcaccaggaacagcatcgcgaggcgagaggtcgtcatgtggcggaa
gcctaccgctttcgcatggcaagcggcctgggagtcggagccccttcggcggtggcggcc
gagcaggggggcccctttcatgcccttggcgggcgccgcatctttccgccggaaatgtcc
cgccaacgaggccgaggagcgcccatgtcgaaggcccacatctatgaggaaggacggagc
ggatggggcgcgcctggggctgccgaggcccgtcacccgagcgggcccgacttcgctccg
gcgctgctgagattggggcaggcgctccaggcggcgctcatcgtcgacgcgcacggacgc
gtgctctggatggacgatgcgctgactcacgccaccgggccgcagggagagccctttcaa
gggcgttccgtggccgaggtgctcgctcggctgccctggctcgcgcaggcgatgcagccc
gcgctccagggcaaggccggtgttcacgaggagccgggcctgacggccttcgtcctgccc
atgttcgatgagcaggggacattgttgggagcctgcgcgcgcctccagcttcctgagtcc
tcgatggggcaggtcgccgaaggcggtctgacgcggcacgcgccggagagcctggcgcac
atgaactcggtgctgcgcgccacgttcgactcgattgcggaaggcgtcatcgtggtggac
ctgaacaagcgcgtcacggccttcaacaagcgcttcctcgacatctgggggctgaccgag
gagatgatggtggaccgcgacgcggagcgggtgctggtgcgcgcggcgggcggcgtgaaa
cacccggagtcgttcacgtcgcgaatccgggagcgcttcgagccgtccgaagaggtggac
gtggagacggtggagttgctggacgggcgcatcctggagcgcaagtcgctgccgcagcgg
atggggggcgccatcatcggccgcgtgtggagctaccgcgaggtgacggcggagcggcag
gccgaggccgagcgcgagcggctgctgcgcgaagcccaggaggccatccgcgtgcgggac
gacttcctgtccatcgccgcgcacgagctgaagacgccgctcacgccgctgaagctgcac
ctccagatgctgcggcaacacggcgccgagggggacggggcctccgcccggcacgtggac
aagtcgttgatgcaggtgagccgcctgacgggattggtgaatgacctgctggacacctcg
cgcatccaggaagggcggctgacgctgaagcatgggcccgtcgtgttgcaggagctggcc
catgacgtcgtctccgagatgcgcctgtccagcgcgcaccaccgggtcgagtacgaagcg
ccggaggcacccctggtcgtcctgggcgacgcggaccggctcgcgcaggtcctggtcaac
ctgatggagaacgccttcaagtacagccccagtgggggaacggttcgcgtccgggtggct
cgggaggaccgccacgcccatgtctccgtccaggacgaaggcatcggcattccgcgggat
cagcaggagcacctcttcgagcgcttcttccgtgctcgcaacgcccccatctccggcttt
ggtgggctggggctggggctctacatctgcggggacatcgtcgagcggcatggcggccgt
ctgtgggtggagagcgtgctggggcacggctccaccttccgcttcaccgtgccgctggcg
tccacgtga

DBGET integrated database retrieval system