KEGG   Myxococcus xanthus: MXAN_0317Help
Entry
MXAN_0317         CDS       T00366                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
mxa  Myxococcus xanthus
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:mxa01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:mxa01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(373213..374007)
Genome map
AA seq 264 aa AA seqDB search
MAVLIFFVSHWLLCVFFQSFFQHRYAAHRMYTMGPKTERVMHLLTYLVQGSSYLSPKAYA
ILHREHHAFSDTEKDPHSPHFFKDVARMMWHTKARYDDYAAGRGQPEARFLGGYPEWPLV
DTTLRTSWFATLGWVAFYSAFYVMFATSPWQFLLLPLHFLMGPVHGAIVNWCGHKYGYRN
FDSTDKSRNSLPMDFLCMGELFQNNHHKYGSSPNFAARKFELDPTWQVMRVLALLRIIHI
ATPQRAVWPEAREAARTGGAARAA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcctcatcttcttcgtctcgcactggctgctctgcgtgttcttccagagcttc
ttccagcaccggtacgcggcccaccgcatgtacaccatggggccgaagacggagcgggtg
atgcacctgctcacctacctggtgcagggctcgtcctacctgtcacccaaggcgtacgcc
atcctccaccgtgagcaccatgccttctccgacacagagaaggacccgcactcgccccac
ttcttcaaggatgtggcgcggatgatgtggcacaccaaggcgcgctacgacgactacgcg
gccggccgcggtcaacccgaggcccgcttcctgggcggctacccggagtggccgctcgtg
gacaccacgctgcgcacctcatggttcgccaccctgggctgggtggccttctactccgcc
ttctacgtgatgttcgccacctcgccctggcagttcctgctgctgcccctgcacttcctc
atgggcccggtgcacggcgccatcgtcaactggtgcggccacaagtacggctaccggaac
ttcgacagcaccgacaagtcgcgcaactccctgcccatggacttcctctgcatgggggag
ctcttccagaacaaccaccataagtacggcagcagccccaacttcgcggcgcggaagttc
gagctggaccccacgtggcaggtgatgcgcgtgctcgccctgctgcgcatcatccacatc
gccaccccgcagcgcgcagtctggccggaggcccgcgaggccgcacgcaccgggggcgct
gctcgggccgcctga

DBGET integrated database retrieval system