KEGG   Myxococcus xanthus: MXAN_0456Help
Entry
MXAN_0456         CDS       T00366                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mxa  Myxococcus xanthus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MXAN_0456
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MXAN_0456
  Lipid metabolism
   00071 Fatty acid degradation
    MXAN_0456
  Amino acid metabolism
   00350 Tyrosine metabolism
    MXAN_0456
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MXAN_0456
   00626 Naphthalene degradation
    MXAN_0456
Enzymes [BR:mxa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MXAN_0456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
520101..521111
Genome map
AA seq 336 aa AA seqDB search
MEGSMRAMVLREVGQPLHETRLPIPRPGPEELLLRVRACAVCRTDLHVVDGELPKPKLPL
VPGHEIVATVEAAGERATAIPVGTRVGVPWLGWSCGHCRFCLAGQENLCEQARFTGYQLD
GGYAEFTVAHQRFCFPLPPEYTDVHAAPLMCAGLIGFRSLRMAGRERRLLGFYGFGAAAH
LLIQVARHQGRRVFAFTRPGDVEGQRFARELGAEWAGDSDTVPPERLDAAILFAPVGALV
PAALRAVDKAGVVVCGGIHMSDIPAFPYALLWEERVVRSVANLTRADALDFLALAPKVPV
RTLVQTFPLSAANDALTALRRGQVHGAAVLEVAALG
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaagcatgcgcgcgatggtgctgcgcgaggtcgggcagcccctgcatgagacg
cggctgcccattcctcgccccggcccggaggagctgttgcttcgcgtgcgcgcctgcgcg
gtctgccgcaccgacctgcacgtcgtggacggtgagctgccgaagcccaagctgccgctg
gtcccaggccatgaaatcgtggccacggtggaggcggcgggcgagcgggcgacggccatt
cccgtgggcacgcgagtgggcgtcccctggctcggctggagctgcggccactgccgcttc
tgtctggccggccaggagaacctctgcgagcaggcacgcttcacggggtaccaactggat
ggtggctacgcggagttcacggtggcccaccagcgcttctgcttccccctgccgcccgag
tacaccgacgtccacgccgcgccgttgatgtgcgcgggcctcatcggctttcgcagcctc
cgcatggcggggagggagcgtcgtctgttgggtttctacggcttcggcgccgcggcccac
ctgctcatccaggtcgcgcgccaccaaggccggcgtgtcttcgccttcacccggccgggg
gacgtggagggccaacggttcgcgcgggagctgggcgcggagtgggccggggattcggac
accgtgcctccggagcggctggacgcggccatcctcttcgcgccggtgggcgcgctggtg
cccgccgcgctccgggcggtggacaaggccggcgtggtggtgtgcggcggcatccacatg
agcgacatccccgcgttcccctatgcgctgctgtgggaggagcgggtggtgcgctcggtg
gcgaacctcacccgggcggatgcgctggacttcctcgcgctcgcgcccaaggtgccggtg
cgcaccctggtgcaaaccttcccactgtccgccgccaacgacgccctcaccgcgctgagg
cgaggccaggtgcacggcgcggcggtgctggaggtggcggccctgggttga

DBGET integrated database retrieval system