KEGG   Myxococcus xanthus: MXAN_0949Help
Entry
MXAN_0949         CDS       T00366                                 

Definition
AMP-binding protein
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mxa  Myxococcus xanthus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MXAN_0949
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MXAN_0949
   00620 Pyruvate metabolism
    MXAN_0949
   00640 Propanoate metabolism
    MXAN_0949
  Energy metabolism
   00680 Methane metabolism
    MXAN_0949
Enzymes [BR:mxa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MXAN_0949
Lipid biosynthesis proteins [BR:mxa01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MXAN_0949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1089438..1091105
Genome map
AA seq 555 aa AA seqDB search
MVSSAQESATMPLSPPRNMKDYEATRRDFRWERPEHFNFAADVIDRHAAERPEALALLWS
DEAGQARRFTWEDLRRRSLHAARFLTEQGLRRGDRVFIMMPRVPEWWFLVLGCIRVGIVF
MPGTPMLTPKDIRYRLEVAEAQAVIADVSCLERFDGLVGTAGKVRTWVSVGEGAPSPWGR
YVSGVAEANAGAAFEPTRADAPLLIYFTSGTTGMPKMVLHTQASYGQGHVITGRYWLDLT
PEDRHLTLSDTGWAKCAWGKLFGPWSQGACNVVYDFRGRFEPAKLLKVLETQKVTTFCAP
PTAWRALVLQDLKAFDLSSLRHTVSAGEPLNPEVIDTWKDATGLHIHEGYGQTETVMIVG
MFPSMAPRVGSMGKPSPGFTVSVIDDQGQEVADGQEGDIAVRVAPERPVGLFQGYLGDDA
ANAACRRGDWYVTGDRAVRDADGYFWFVGRADDVIKTSGYRVGPFEVESALLEHDAVAES
AVIGVPDEKIGQRVKAFVVLAPGHTASPVLAQALQEHVKRTTAPYKYPREIEFVTELPKT
VSGKIRRAELRTTRT
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
ttggtttcttccgcccaggagtcggccaccatgcccctgtcaccccctcggaacatgaag
gactacgaggccacccgccgggactttcgctgggagcggcccgagcacttcaacttcgcg
gccgacgtcatcgaccggcacgccgccgagcgcccggaggcgctggccctgctgtggtcc
gacgaagccgggcaggcgcggcgcttcacgtgggaggacttgcggcggcgctcgctgcac
gcggcccgcttcctgacggagcaggggcttcgccggggggaccgggtcttcattatgatg
ccgcgcgtgccggagtggtggttcctggtgctgggctgcattcgcgtgggcatcgtcttc
atgccgggcacgcccatgctcacgccgaaggacatccgttaccggttggaggtggcggag
gcccaggcggtgattgcggacgtgagctgcctggagcgcttcgacggcctggtggggacg
gccggcaaggtccgcacctgggtgtcggtgggcgagggcgcgccgtctccgtgggggcgc
tacgtgtccggcgtcgcggaggcgaacgcgggcgcggccttcgagcccacgcgcgcggat
gcgccgctgctcatctacttcacgtccggcaccacgggcatgccgaagatggtgctgcac
acgcaggccagctacgggcaggggcacgtgattaccggccgctactggctggacctgacg
ccggaggaccggcacctgacgctcagcgacaccggctgggccaagtgcgcgtggggcaag
ctcttcggcccgtggagtcagggcgcgtgcaacgtcgtctatgacttccgtggccgcttc
gagcccgcgaagctgctgaaggtgctggagacgcagaaggtcaccaccttctgcgcgccg
cccaccgcgtggcgggcgctggtgctccaggacttgaaggccttcgacctgtcctcgctg
cggcacacggtgagcgcgggcgagccgctcaatccggaagtcatcgacacgtggaaggat
gccaccgggctgcacatccatgagggctacgggcagacggagacggtgatgattgtgggc
atgttcccctccatggcgccgcgcgtgggttccatgggcaagccgtccccgggcttcacg
gtgagcgtcatcgacgaccagggccaggaggtggcggacgggcaagagggggacatcgcg
gtgcgcgtggcgcccgagcggcccgtggggttgttccagggctatctcggggacgacgcg
gccaacgcggcgtgccggcgtggtgactggtacgtgacgggagaccgggccgtgcgcgac
gcggacggctacttctggttcgtgggacgcgcggatgacgtcatcaagacgtcgggctac
cgcgtggggcccttcgaggtggagtccgcgctgctggagcacgacgcagtggcggagtcg
gccgtcatcggtgtgccggacgagaagattggccagcgggtgaaggccttcgtggtgctg
gcgccggggcatacggcatccccggtgctcgcgcaggcgttgcaggagcacgtgaagcgg
acgacggcgccctacaagtacccgcgcgaaatcgagttcgtcaccgagctgcccaagacg
gtgagcgggaagattcgccgcgcggagctgcgcaccacgcggacgtag

DBGET integrated database retrieval system