KEGG   Myxococcus xanthus: MXAN_0949Help
Entry
MXAN_0949         CDS       T00366                                 

Definition
AMP-binding protein
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mxa  Myxococcus xanthus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:mxa01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mxa00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mxa00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mxa00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:mxa00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1089438..1091105
Genome map
AA seq 555 aa AA seqDB search
MVSSAQESATMPLSPPRNMKDYEATRRDFRWERPEHFNFAADVIDRHAAERPEALALLWS
DEAGQARRFTWEDLRRRSLHAARFLTEQGLRRGDRVFIMMPRVPEWWFLVLGCIRVGIVF
MPGTPMLTPKDIRYRLEVAEAQAVIADVSCLERFDGLVGTAGKVRTWVSVGEGAPSPWGR
YVSGVAEANAGAAFEPTRADAPLLIYFTSGTTGMPKMVLHTQASYGQGHVITGRYWLDLT
PEDRHLTLSDTGWAKCAWGKLFGPWSQGACNVVYDFRGRFEPAKLLKVLETQKVTTFCAP
PTAWRALVLQDLKAFDLSSLRHTVSAGEPLNPEVIDTWKDATGLHIHEGYGQTETVMIVG
MFPSMAPRVGSMGKPSPGFTVSVIDDQGQEVADGQEGDIAVRVAPERPVGLFQGYLGDDA
ANAACRRGDWYVTGDRAVRDADGYFWFVGRADDVIKTSGYRVGPFEVESALLEHDAVAES
AVIGVPDEKIGQRVKAFVVLAPGHTASPVLAQALQEHVKRTTAPYKYPREIEFVTELPKT
VSGKIRRAELRTTRT
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
ttggtttcttccgcccaggagtcggccaccatgcccctgtcaccccctcggaacatgaag
gactacgaggccacccgccgggactttcgctgggagcggcccgagcacttcaacttcgcg
gccgacgtcatcgaccggcacgccgccgagcgcccggaggcgctggccctgctgtggtcc
gacgaagccgggcaggcgcggcgcttcacgtgggaggacttgcggcggcgctcgctgcac
gcggcccgcttcctgacggagcaggggcttcgccggggggaccgggtcttcattatgatg
ccgcgcgtgccggagtggtggttcctggtgctgggctgcattcgcgtgggcatcgtcttc
atgccgggcacgcccatgctcacgccgaaggacatccgttaccggttggaggtggcggag
gcccaggcggtgattgcggacgtgagctgcctggagcgcttcgacggcctggtggggacg
gccggcaaggtccgcacctgggtgtcggtgggcgagggcgcgccgtctccgtgggggcgc
tacgtgtccggcgtcgcggaggcgaacgcgggcgcggccttcgagcccacgcgcgcggat
gcgccgctgctcatctacttcacgtccggcaccacgggcatgccgaagatggtgctgcac
acgcaggccagctacgggcaggggcacgtgattaccggccgctactggctggacctgacg
ccggaggaccggcacctgacgctcagcgacaccggctgggccaagtgcgcgtggggcaag
ctcttcggcccgtggagtcagggcgcgtgcaacgtcgtctatgacttccgtggccgcttc
gagcccgcgaagctgctgaaggtgctggagacgcagaaggtcaccaccttctgcgcgccg
cccaccgcgtggcgggcgctggtgctccaggacttgaaggccttcgacctgtcctcgctg
cggcacacggtgagcgcgggcgagccgctcaatccggaagtcatcgacacgtggaaggat
gccaccgggctgcacatccatgagggctacgggcagacggagacggtgatgattgtgggc
atgttcccctccatggcgccgcgcgtgggttccatgggcaagccgtccccgggcttcacg
gtgagcgtcatcgacgaccagggccaggaggtggcggacgggcaagagggggacatcgcg
gtgcgcgtggcgcccgagcggcccgtggggttgttccagggctatctcggggacgacgcg
gccaacgcggcgtgccggcgtggtgactggtacgtgacgggagaccgggccgtgcgcgac
gcggacggctacttctggttcgtgggacgcgcggatgacgtcatcaagacgtcgggctac
cgcgtggggcccttcgaggtggagtccgcgctgctggagcacgacgcagtggcggagtcg
gccgtcatcggtgtgccggacgagaagattggccagcgggtgaaggccttcgtggtgctg
gcgccggggcatacggcatccccggtgctcgcgcaggcgttgcaggagcacgtgaagcgg
acgacggcgccctacaagtacccgcgcgaaatcgagttcgtcaccgagctgcccaagacg
gtgagcgggaagattcgccgcgcggagctgcgcaccacgcggacgtag

DBGET integrated database retrieval system