KEGG   Myxococcus xanthus: MXAN_0977Help
Entry
MXAN_0977         CDS       T00366                                 

Definition
di-heme cytochrome-c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
mxa  Myxococcus xanthus
Brite
Enzymes [BR:mxa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     MXAN_0977
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1125961..1127100
Genome map
AA seq 379 aa AA seqDB search
MAWRVGRRAGVLAVLAWLGAGCGGKDGEAERYVWKLPTGFPTPRVPADNPMTEEKVQLGR
RLFFDVRLSRNETQSCASCHDPARAFTEPLMTSQGSTGETHRRNSQGLANVAYATSLTWA
NPSLTTLEAQALVPLFGKEPVELGFGDREEELLGRLRAVPELEAEFQRAFPEAVEPVSVA
TLTRALASFQRTLISGNSAYDRYVYGNDVEAMTRQQKRGMELFFSERLECDHCHSGFNFQ
DATVHETTSEPIFPYHNTGLYNVDGQGAYPAKDPGLIELTGRPEDMGRFRAPSLRNVAVT
GPYMHDGSLATLSDVLDHYAAGGHARRVRGGEASPLQSGFVRGFTLTAEEKEDVLAFLES
LTDTEFLTDPRFSDPSSVP
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggcgtggcgcgtgggaagaagagcaggggtactggcggtgctggcctggctgggcgcg
ggttgtggcggcaaggacggcgaggcggagcgctacgtgtggaagctgcccacggggttt
cccacgccgcgagtgcccgcggacaatccgatgacggaggagaaggtgcagttgggccgg
aggctcttcttcgacgtgcgcctgtcacggaacgagacgcagtcctgcgcgtcctgccat
gacccggcgcgggccttcaccgagcccctgatgacgtcgcagggcagcacgggcgagacg
caccgccgcaactcccaggggctggccaacgtcgcctatgccacgagtctcacctgggcg
aatccctcgctcacgacgctggaggcgcaggcgttggtgcccttgttcggcaaggagccg
gtggagttgggcttcggtgacagggaagaggagttgctcggccgactgcgcgcggtcccg
gaactggaggcggagttccagcgcgcgtttccggaggccgtggagcccgtgtccgtggcc
acgctgacgcgggcgctggcgtcgttccagcgcaccctcatctccggcaactccgcgtat
gaccgctatgtgtatggcaatgacgtggaggccatgacgcggcagcagaagcggggcatg
gagttgttcttctcggagcggctggagtgtgaccattgccactccggcttcaacttccag
gacgccacggtgcacgagacgacgtccgagcccatcttcccctaccacaacacgggcctg
tacaacgtggacgggcagggggcgtatccggcgaaggacccgggcctcatcgagctgacg
ggccgtcccgaggacatgggccgcttccgcgcgccgtccctgcgcaacgtggccgtcacc
gggccgtacatgcatgacggcagtctggccacgctgtcggacgtgctggaccactacgcc
gcgggaggacacgcgcggcgggtgcgcggcggcgaggccagtccgctgcaaagtggcttc
gtgagaggcttcacgttgaccgcggaggagaaggaagacgtcttggcgttcctcgagtcg
ctcaccgacacggagttcctgacggacccgcgcttctcggacccgtccagcgtgccgtga

DBGET integrated database retrieval system