KEGG   Myxococcus xanthus: MXAN_1039Help
Entry
MXAN_1039         CDS       T00366                                 

Gene name
glkA
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mxa  Myxococcus xanthus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MXAN_1039 (glkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MXAN_1039 (glkA)
   00052 Galactose metabolism
    MXAN_1039 (glkA)
   00500 Starch and sucrose metabolism
    MXAN_1039 (glkA)
   00520 Amino sugar and nucleotide sugar metabolism
    MXAN_1039 (glkA)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MXAN_1039 (glkA)
   00524 Butirosin and neomycin biosynthesis
    MXAN_1039 (glkA)
Enzymes [BR:mxa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MXAN_1039 (glkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1213403..1214425
Genome map
AA seq 340 aa AA seqDB search
MREANAVGSRGKAAERDTLECWGGVDLGGTKIEAVVVDRAGTVLGKMRQPTPADGEPGDV
VRAIHDALEGAAHAAGLTSRQLLGVGVGAPGAVNANEGTLGHVSNVGRGWSTPYPVAGDL
GARVGRPVVLGNDVQVAVAAEYRLGAGRAFRSLLGVWWGTGVGGGLVLDGVPWRGRGAAG
EVGHMVVKPGGARCGCGRRGCLEAYAGRASMERRAHKAVRQGETTILFDLMRKKGRTRLT
SSIWARALAQEDALATWLFGRAVRMLGAGLASAINLLDVEAVVLGGGLGTRLGPEFAGRI
HEAMRPHIFVPERQPPVRVAELGELSGAIGAALLAQPPMK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcgggaggcgaacgcggtgggctcgcgagggaaggcggcggagcgcgacaccctggag
tgctggggcggcgtcgacctgggcgggacgaaaatcgaggccgtggtggtggaccgcgcc
ggcaccgtcctggggaagatgcgccagcccacgcccgccgacggcgagcccggcgacgtg
gtgcgcgccatccacgacgccttggagggcgcggcgcacgcggcgggcctgacgtcccgt
cagctcctgggggtgggcgtgggcgcgcccggcgcggtgaacgccaacgagggcacgctg
ggacatgtcagcaacgtgggccggggctggagcacgccctacccagtggcgggggacctg
ggcgcgcgggtgggccggcccgtggtgctgggcaacgacgtccaggtggcggtggcggcg
gagtaccggctgggcgcgggccgcgcatttcgctccctgctgggcgtctggtggggaacg
ggcgtgggcggtgggctggtgctggacggcgtgccctggcgaggccggggcgcggcgggc
gaggtgggccacatggtggtgaagccgggcggtgcccggtgtggttgtggccggcgcggc
tgcctggaggcctacgcgggccgcgcgtccatggagcgccgtgcgcacaaggccgtgcgc
cagggcgagacgacgattctcttcgacttgatgcggaagaagggccgcacccggttgacc
agcagcatctgggcccgggcgctggcgcaggaggacgcactggccacgtggctcttcggc
cgcgcggtgcggatgctgggcgcggggctcgcctccgccatcaacctgctggacgtggag
gcagtcgtcctgggcggaggcctgggcacgcggctggggcctgaattcgccggccgcatc
cacgaggccatgcgcccgcacatcttcgtccccgagcgccagccgcccgtgcgcgtcgcg
gaactgggagaactttccggtgccattggcgccgcgctgctggcccagccacccatgaag
tga

DBGET integrated database retrieval system