KEGG   Myxococcus xanthus: MXAN_1293Help
Entry
MXAN_1293         CDS       T00366                                 

Gene name
hemG
Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
mxa  Myxococcus xanthus
Pathway
mxa00860  Porphyrin and chlorophyll metabolism
mxa01100  Metabolic pathways
mxa01110  Biosynthesis of secondary metabolites
Module
mxa_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MXAN_1293 (hemG)
Enzymes [BR:mxa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     MXAN_1293 (hemG)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     MXAN_1293 (hemG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_2 Pyr_redox Thi4 FAD_oxidored HI0933_like Lycopene_cycl FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ABF92067
UniProt: Q1DCS3
Structure
PDB: 

Jmol
Position
complement(1518704..1520119)
Genome map
AA seq 471 aa AA seqDB search
MHHMPRTTGMNVAVVGGGISGLAVAHHLRSRGTDAVLLESSARLGGAVGTHALAGYLVEQ
GPNSFLDREPATRALAAALNLEGRIRAADPAAKRRYVYTRGRLRSVPASPPAFLASDILP
LGARLRVAGELFSRRAPEGVDESLAAFGRRHLGHRATQVLLDAVQTGIYAGDVEQLSVAA
TFPMLVKMEREHRSLILGAIRAQKAQRQAALPAGTAPKLSGALSTFDGGLQVLIDALAAS
LGDAAHVGARVEGLAREDGGWRLIIEEHGRRAELSVAQVVLAAPAHATAKLLRPLDDALA
ALVAGIAYAPIAVVHLGFDAGTLPAPDGFGFLVPAEEQRRMLGAIHASTTFPFRAEGGRV
LYSCMVGGARQPGLVEQDEDALAALAREELKALAGVTARPSFTRVFRWPLGIPQYNLGHL
ERVAAIDAALQRLPGLHLIGNAYKGVGLNDCIRNAAQLADALVAGNTSHAP
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgcaccacatgccgaggacaactggaatgaatgtcgccgtcgtgggaggtgggatttcg
gggttggccgtcgcgcatcatttgcgctcgcgcggtacggatgccgtgcttctggagtcc
tccgcccgacttggcggcgcggtgggcacgcatgcgctcgccggctacctggtggagcag
gggcccaacagcttcctggaccgcgagcccgcaacgcgggcgctcgcggcggcgctgaat
ctggaggggcgaattcgcgccgcggacccggcggcgaagcgtcgctatgtctacacgcgg
ggcagactccggtcggtaccggcctcgccgcccgcgtttctcgcatcggacattctgccg
ctcggcgcgcggttgcgcgtcgctggcgaactgttctcccgccgcgcgccggagggtgtg
gacgaatcgctggccgccttcggccgccgccacctgggacacagggcgacgcaggtgctg
ctcgacgcggtgcagacgggcatctacgcgggcgacgtggagcagctcagcgtcgcggcc
accttccccatgctggtgaagatggagcgcgagcaccgcagcctcatcctgggcgccatc
cgcgcgcagaaggctcagcgccaggcggcgctccccgcgggaacggcgccgaagttgagc
ggcgcgctgagcacgttcgacggcggattgcaggtgctcatcgacgcgctcgccgcatcg
ttgggtgacgcggcgcacgtgggcgcgcgcgtggaggggctggcgcgcgaggacggcggt
tggaggctcatcatcgaggagcacggacgccgcgcggaactgtccgtggcccaggtggta
ctggcggcgcccgcgcatgccaccgcgaaattgctacgcccactggatgacgcgctcgcc
gccctggtggcgggtatcgcctatgcgcccatcgcggtggtgcacctgggcttcgacgcg
gggacacttccggcgccggatggctttgggttcctggtgccagcggaggagcagcggcgg
atgctgggcgccatccacgcgtccaccacctttcccttccgggccgagggcggacgcgtg
ctctattcctgcatggtggggggcgcgcgtcagccagggctggtggaacaggacgaggat
gcattggcggcgctggcgcgcgaggaactgaaggcgctggcaggcgtgacggcgcgcccc
tccttcacgcgggtgttccgctggccgcttggcattccccagtacaacctgggacacctg
gagcgcgtggccgctatcgacgcggcgctgcaacgcttgcccggcctgcacctcatcggg
aatgcgtacaagggcgtgggcctcaacgactgcatccgcaacgcggcgcaactcgcggac
gccctggtcgcggggaacacctcccacgccccgtag

DBGET integrated database retrieval system