KEGG   Myxococcus xanthus: MXAN_1293Help
Entry
MXAN_1293         CDS       T00366                                 

Gene name
hemG
Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
mxa  Myxococcus xanthus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mxa00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1518704..1520119)
Genome map
AA seq 471 aa AA seqDB search
MHHMPRTTGMNVAVVGGGISGLAVAHHLRSRGTDAVLLESSARLGGAVGTHALAGYLVEQ
GPNSFLDREPATRALAAALNLEGRIRAADPAAKRRYVYTRGRLRSVPASPPAFLASDILP
LGARLRVAGELFSRRAPEGVDESLAAFGRRHLGHRATQVLLDAVQTGIYAGDVEQLSVAA
TFPMLVKMEREHRSLILGAIRAQKAQRQAALPAGTAPKLSGALSTFDGGLQVLIDALAAS
LGDAAHVGARVEGLAREDGGWRLIIEEHGRRAELSVAQVVLAAPAHATAKLLRPLDDALA
ALVAGIAYAPIAVVHLGFDAGTLPAPDGFGFLVPAEEQRRMLGAIHASTTFPFRAEGGRV
LYSCMVGGARQPGLVEQDEDALAALAREELKALAGVTARPSFTRVFRWPLGIPQYNLGHL
ERVAAIDAALQRLPGLHLIGNAYKGVGLNDCIRNAAQLADALVAGNTSHAP
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgcaccacatgccgaggacaactggaatgaatgtcgccgtcgtgggaggtgggatttcg
gggttggccgtcgcgcatcatttgcgctcgcgcggtacggatgccgtgcttctggagtcc
tccgcccgacttggcggcgcggtgggcacgcatgcgctcgccggctacctggtggagcag
gggcccaacagcttcctggaccgcgagcccgcaacgcgggcgctcgcggcggcgctgaat
ctggaggggcgaattcgcgccgcggacccggcggcgaagcgtcgctatgtctacacgcgg
ggcagactccggtcggtaccggcctcgccgcccgcgtttctcgcatcggacattctgccg
ctcggcgcgcggttgcgcgtcgctggcgaactgttctcccgccgcgcgccggagggtgtg
gacgaatcgctggccgccttcggccgccgccacctgggacacagggcgacgcaggtgctg
ctcgacgcggtgcagacgggcatctacgcgggcgacgtggagcagctcagcgtcgcggcc
accttccccatgctggtgaagatggagcgcgagcaccgcagcctcatcctgggcgccatc
cgcgcgcagaaggctcagcgccaggcggcgctccccgcgggaacggcgccgaagttgagc
ggcgcgctgagcacgttcgacggcggattgcaggtgctcatcgacgcgctcgccgcatcg
ttgggtgacgcggcgcacgtgggcgcgcgcgtggaggggctggcgcgcgaggacggcggt
tggaggctcatcatcgaggagcacggacgccgcgcggaactgtccgtggcccaggtggta
ctggcggcgcccgcgcatgccaccgcgaaattgctacgcccactggatgacgcgctcgcc
gccctggtggcgggtatcgcctatgcgcccatcgcggtggtgcacctgggcttcgacgcg
gggacacttccggcgccggatggctttgggttcctggtgccagcggaggagcagcggcgg
atgctgggcgccatccacgcgtccaccacctttcccttccgggccgagggcggacgcgtg
ctctattcctgcatggtggggggcgcgcgtcagccagggctggtggaacaggacgaggat
gcattggcggcgctggcgcgcgaggaactgaaggcgctggcaggcgtgacggcgcgcccc
tccttcacgcgggtgttccgctggccgcttggcattccccagtacaacctgggacacctg
gagcgcgtggccgctatcgacgcggcgctgcaacgcttgcccggcctgcacctcatcggg
aatgcgtacaagggcgtgggcctcaacgactgcatccgcaacgcggcgcaactcgcggac
gccctggtcgcggggaacacctcccacgccccgtag

DBGET integrated database retrieval system