KEGG   Myxococcus xanthus: MXAN_1389Help
Entry
MXAN_1389         CDS       T00366                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
mxa  Myxococcus xanthus
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mxa00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:mxa00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:mxa02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1631694..1633919
Genome map
AA seq 741 aa AA seqDB search
MFPAEWKSALDSRPCLLTRATRSPALFDRFKRRSFLQAVVAVAATTAFGCSDDETTSDAG
EKYFPQSVCSGDPRPDSVVLWVRAVDPDNAGANTQVRLEVSTSESFSSVVLDQQFTAQAQ
FDHALKVKVTNLSARTTYYYRFTIDANGQKYSTVTGRTRTAPAAGDDVPVKFVFASCQDY
IGRYYNAWQHLLQLNEDLDFVVFLGDYVYETTGDASFQSVDGRGIVFSEPEKALRQGTGL
TAFYAANSLSNYRDLYKTLRTDKVIQQVHERYPFVITWDDHEFSDDCWGDVATYTDERTN
EKQTERRRNAEQAFFEYIPMDHGASDAGAIDINAVVAQPTRIYRDFEFGRNLKLLVTDTR
TYRPDHLIPEDAYPGKVAVPAEQLALVLSSLPEATQAQLQSDMFAYVDIDAAELAPYKQI
LTGVYVQQAVAAGLTSGEATEKAGAWVSGGLSLFYVNQVLNAVNQAREAAGDSAIPLIPA
TGAPRGLAYAHMGKTGLFGIQGSRYVVVKPIFDLYAAIKYMGTAGASEGIFGNEQQAWLQ
ESVQADNAWKIIVSSISLTSMVFKLSEKADVPDPTLRQDFYFNVDQWDGFPTKKQEFLKF
LRDSQVKNALFISGDIHASFASVESGIPALTTPAISSGSIKELAGLAVIGAGFSTGSTVY
RYIVTELDKSLKEAHPGMAFVDGDAHGFVVLEVGGTEAKAAFHLIPSTEIAKDYSLRQPS
ELTAKFTRRDFIIKDGTITSA
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgtttcctgctgagtggaagagcgctctagactcgcggccctgtctcctaacccgcgca
acccggagtcccgccttgttcgatagattcaaacgccgcagtttcctccaggccgtcgtc
gccgttgccgcgaccactgcgttcggatgttccgacgacgagacgacgtcggatgctggc
gagaagtacttcccgcagtccgtgtgctcgggtgacccgcgtccggacagcgtggtgttg
tgggtgcgggcggtggacccggacaacgcgggggcgaacacgcaggtgcggctggaggtg
tccaccagcgagtcgttcagcagcgtggtgctggaccagcagttcaccgcgcaggcgcag
ttcgaccatgcgttgaaggtgaaggtcaccaacctgtcggcgcgcacgacgtactactac
cgcttcaccatcgacgcgaacggtcagaagtactccacggtgacgggccgcacccgcacc
gcgccggccgcgggcgacgacgtgccggtgaagttcgtcttcgccagctgccaggactac
atcggtcgttactacaacgcgtggcagcacctgctgcagctcaacgaggacctcgacttc
gtcgtgttcctgggcgactacgtctacgagacgacgggcgacgcgtcgttccagtccgtg
gacggacgcggcatcgtcttcagcgagcccgagaaggcgctccgccagggcacgggcctg
acggcgttctacgcggccaactcgctgtccaactaccgcgacctctacaagaccctgcgc
acggataaggtcatccagcaggtgcacgagcgctacccgttcgtcatcacgtgggatgac
cacgagttctccgacgactgctggggcgacgtcgccacgtacacagacgagcgcaccaac
gagaagcagaccgagcgccgccgcaacgcggagcaggccttcttcgagtacatccccatg
gaccacggcgcgagcgacgcgggcgccatcgacatcaacgccgtggtggcccagccgacg
cgcatctaccgcgacttcgagttcggccggaacctgaagctgctggtgacggacacgcgc
acgtaccgcccggaccacctcatccccgaggacgcgtacccgggcaaggtggcggtgccg
gccgagcagctggccctggtgctgtcgtcgctgccggaggccacgcaggcgcagttgcag
tccgacatgttcgcctacgtggacatcgacgcggcggagctggcgccctacaagcagatc
ctcacgggcgtgtacgtgcagcaggccgtcgccgccgggctcacgtcgggagaggcgacc
gagaaggcgggcgcctgggtctccggtgggctgtcgctgttctacgtcaaccaggtgctc
aacgccgtcaaccaggcgcgtgaggcggcgggcgattcggccattccgctcatccccgcg
acgggcgcgccgcgcggtctggcctatgcgcacatgggcaagacgggcctcttcggcatc
cagggctcgcgctacgtcgtggtgaagcccatcttcgacctgtacgcggccatcaagtac
atgggcaccgcgggagcctcggagggcatcttcggcaacgagcagcaggcgtggctccag
gagtccgtgcaggcggacaacgcgtggaagatcatcgtctcctcgatttcgctcacctcc
atggtgttcaagctgagcgagaaggcggacgtcccggaccccacgctgcgccaggacttc
tacttcaacgtggaccagtgggacggcttccccacgaagaagcaggagttcttgaagttc
ctgcgcgacagccaggtgaagaacgcgctgttcatctccggcgacatccacgcgtccttc
gcgtccgtggagtccggcatccccgcgctgacgacgccggccatctcctccggctccatc
aaggagctggcgggcctggccgtcatcggcgcgggcttctccaccggcagcacggtgtac
cggtacatcgtgacggagctggacaagtcgctgaaggaagcgcaccccggcatggcgttc
gtggacggtgatgcccacggcttcgtggtgctggaggtcggcggcacggaggcgaaggcg
gccttccacctcatcccgagcacggaaatcgccaaggactactcgctgcgccagccctcc
gagctgacggcgaagttcacccgccgcgacttcatcatcaaggacggcaccatcacctcc
gcctga

DBGET integrated database retrieval system