KEGG   Myxococcus xanthus: MXAN_1425Help
Entry
MXAN_1425         CDS       T00366                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mxa  Myxococcus xanthus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MXAN_1425 (galU)
   00052 Galactose metabolism
    MXAN_1425 (galU)
   00500 Starch and sucrose metabolism
    MXAN_1425 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    MXAN_1425 (galU)
Enzymes [BR:mxa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MXAN_1425 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1677411..1678313
Genome map
AA seq 300 aa AA seqDB search
MASKTSKVEPLIRKCVIPAAGLGTRFLPATKAVPKEMLPIVDTPTLQYIVEEAVSAGIED
VVLINGRGKGAIEDHFDIGFELETTLRARGKDSEADKLRAIADLVRVVSIRQKEPKGLGH
AVLCAKSVIGDEPFGVLLGDDMIDAEEPGIRQLARVYRQYNQAVIALMEVPESETHMYGI
AAGTDLGDGVMRIDRIVEKPKKGTAPSNLAVIGRYVLPPDIFPILENQTPGVGGEIQLTD
GLATLQQSKGLLGYRFKGQRYDAGDKVGYLKANIAYALKRPDLRAGLLEYMREVVKTEKP
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggcctccaaaacctcgaaggtagagcccctcatccgcaagtgtgtcatcccggcagcc
ggcctgggcacgcgcttcctgccggcgaccaaggcggttcccaaggagatgctgcctatc
gtcgatactccgacgctccagtacatcgtggaagaggcggtatccgccggcatcgaggat
gtcgtcctcatcaatggccgcggcaagggcgccatcgaggaccacttcgacatcggcttc
gaactggagacgacgctgcgtgcgcgcggcaaggattccgaggccgacaagctgcgcgcc
atcgcggacctcgtgcgcgtcgtcagcatccgtcagaaggagcccaagggactgggccac
gcggtgctgtgcgccaagagcgtcatcggcgacgagcccttcggcgtgctgctgggcgac
gacatgattgatgccgaggagccgggaatccgccagctcgctcgcgtgtaccgccagtac
aaccaggcggtcatcgcgctcatggaagtgccggagagtgagacgcacatgtacggcatc
gccgcgggcacggacctgggtgatggcgtcatgcgcatcgaccgcatcgtggagaagccg
aagaagggcactgcgccctccaacctcgccgtcatcggccgctacgtgctgccgcccgac
atcttccccatcctggagaaccagacgccgggtgtgggcggcgaaatccagctcaccgac
ggcctggccacgctccagcagtcgaaggggctgctcggctaccgcttcaagggtcagcgc
tatgacgcgggcgacaaggtggggtacctgaaggccaacatcgcctacgcgctcaagcgt
ccggacctgcgtgccgggctgctcgagtacatgcgtgaagtcgtgaagacggagaagccg
tga

DBGET integrated database retrieval system