KEGG   Myxococcus xanthus: MXAN_1504Help
Entry
MXAN_1504         CDS       T00366                                 

Definition
GMC family oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
mxa  Myxococcus xanthus
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    MXAN_1504
Enzymes [BR:mxa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     MXAN_1504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1765013..1767358
Genome map
AA seq 781 aa AA seqDB search
MRRLSSPWSELASHYAVVVVGSGYGGAITASRLARAGQQVCVLERGRELLPGDYPRTDAE
FMSEFQVHFDPEAAADVGSPTALFELHRGGDVSVVTGCGLGGTSLINANVAMRPDPRVFL
DGRWPDAFRADVDGLLEDGFAWAEHMLRPLPYPESAPPLATLSALAKSAEKLGGTFRRPP
LAVTFEEGVNAAGVRQGACTLCGDCMTGCNFGAKNSVLMNYLPDAHRHGAKLFTEVGVRY
LARDGARWRVYYRPMNAGRERFDAPDLWLTADRVILAAGTMGTAELLLRSKALGLSLSGR
LGQRFSNNGDVMAFGYNTDVPVYGVGLGEAPSAGREPVGPTITGIIDDRATLRQEDGMII
ENGAIPAALARPVTALLAAASAIAGQDTDRGVIDRVGELARIADSAVRGPYHGAMRNTQT
FLVMSHDDGAGELRLSGDRVRVHWPGAGRQAVFTRVDERLRRATEALGGTFVRNPLWNKL
TGHELLCTHPLGGCAMGERAEEGVVDHEGRVFAGPEGTEVHEGLYVSDGSVIPRPLGINP
LLTISAVAERTVALMARRHGWSVDYSPVPEAPGPRPTQPLAVQFTETMYGYISAGADEDF
LRAGDPARRDTSPFRFIVTVDSRDLEETLAHPLHPMQLSGCVVAPVLSSRPMTVERGVLH
LMTHEGARPGGRRMRYQLPLVSESGERFFVDGYKDVHDDDGPDLWVDTTRLLVSIFRGED
ASGRCIFRGYLRLNAKDFAVQLSTLRVLHAQGTVQRLAALARFGRFFFGELFETYVRSKA
A
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atgcggaggttgtcgtcaccttggagtgagctggcgtcgcattacgccgtggtggtggtg
ggctcggggtacggaggggccatcaccgccagccgattggctcgcgcgggccagcaggtc
tgtgtcctggagcgaggccgggagctcctgcccggtgactacccgcgcacggacgccgag
ttcatgtccgagttccaggttcacttcgaccccgaagccgccgccgatgtgggcagtccg
acggccttgttcgagctccaccggggcggggatgtctccgtcgtcacgggctgcggcctg
ggcgggacgtcgctcatcaatgccaacgtggccatgcggccggaccctcgcgtgttcctg
gatgggcgttggccggacgcgttccgcgccgacgtggacggcttgctggaggacggcttc
gcttgggccgagcacatgctgcggccattgccctatccggaatccgcgccgccgctggcc
acgctgtcggcgctggcgaaatcggcggagaagctgggcggcacctttcgccggcctccc
ctggccgtcaccttcgaggagggcgtcaacgccgcgggggtgcgtcagggcgcttgcacg
ttgtgcggtgactgcatgacgggctgcaacttcggcgcgaagaactccgtgctgatgaac
tacctgccggacgcgcaccgccatggggcgaagctcttcaccgaggtgggcgtgcgctac
ctggcgcgcgatggtgcccggtggcgcgtgtactaccggccgatgaacgccggccgcgag
cggttcgatgcgccagacctgtggttgaccgccgaccgcgtcatcctcgcggcggggacc
atgggcaccgcggagctcctgcttcgctcgaaggcgctggggttgtccctctccgggcgt
ctgggccagcgtttcagcaacaacggggacgtgatggcgttcggttacaacacggacgtc
ccggtctatggcgtgggtctgggcgaggcgccctccgcggggcgcgagcccgtgggtccc
accatcaccggtatcatcgatgaccgggccacgctgcggcaggaagacggcatgatcatc
gagaacggcgcgattcccgccgcgctcgcgcgtcccgtgacggcgctgctcgccgcggcg
tcggccatcgccgggcaggacacggaccggggcgtcatcgaccgggttggggaactggcg
cgcatcgcggacagtgccgtgcgcggcccgtaccacggggccatgcgcaacacgcagacg
ttcctcgtgatgtcccatgatgacggcgcgggtgaactgcgcctgtcgggtgaccgggtc
cgcgttcactggccaggcgcggggcggcaggccgtcttcacgcgggtggatgaacgcctg
cgtcgcgccacggaggcgctgggcgggaccttcgtgcgcaatccgctctggaacaagctc
accggccacgaactgctgtgcacccatcccttgggcgggtgcgccatgggcgagcgcgcg
gaggagggcgtggtggaccacgagggccgcgtcttcgcggggcccgagggcacggaggtc
cacgagggcctctacgtcagcgacggctccgtgattcccaggccgctgggcatcaacccg
ctgctcaccatctccgcggtggcggagcgcaccgtggcgctgatggcccggcggcacggt
tggagcgtggactactcgccggttccggaggccccggggccgcggcccacgcagcccctg
gccgtgcagttcaccgagaccatgtacggctacatctccgcgggggccgacgaggacttc
ctgcgagccggggaccccgcgcgcagggatacgtcgccgttccgcttcatcgtcacagtg
gactcacgggacctggaggagacgctcgcgcatccgctgcaccccatgcaactgtcgggc
tgcgtggtggcgcccgtgctgtcctcccgtccgatgacggtggagcggggcgtgctgcac
ctgatgacccacgagggcgctcgtcctggcggacggcggatgcgctaccagctcccgctg
gtctccgagtccggcgagcgcttcttcgtcgacggctacaaggacgtccatgacgacgac
ggtccggacttgtgggtggacaccacgcggctcctggtgtccatcttccgcggcgaggac
gcttcggggcgctgcatcttcaggggctacctgcggctgaacgccaaggacttcgccgtg
cagctctccaccctacgggtgctccatgcccagggtacggtgcagcggctggccgcgctc
gcccgcttcggacgtttcttcttcggggaactcttcgagacgtacgtgcgcagcaaggcc
gcgtag

DBGET integrated database retrieval system