KEGG   Myxococcus xanthus: MXAN_1930Help
Entry
MXAN_1930         CDS       T00366                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mxa  Myxococcus xanthus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mxa03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(2264989..2265582)
Genome map
AA seq 197 aa AA seqDB search
MTPDPLNRLVAQLAKLPGIGEKTAQRLAFHILRAPGEYAAELSQAIREVKEKVHLCVRCF
SLTDAETCNFCRDARRDERVLCVVETFADLMALERTREFKGRYHVLHGVLSPLEGVGPDQ
LRIRELLERLNDSRVEELILATNPDVEGEATALYLTRLLKPMGLRVTRIAQGLPMGGDLE
FADQATLAKALSARRDL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgacccccgatccgctgaatcgactcgtcgcccagctcgcgaagctgccgggcatcggc
gagaagaccgcgcagcgcctcgcgttccacatcctgcgggcgccgggtgagtatgccgcg
gagctgtcgcaggccattcgcgaggtgaaggagaaggtgcacctgtgcgtgcgctgcttc
tccctcaccgacgcggagacctgcaacttctgccgggatgctcggcgcgacgagcgcgtg
ctgtgcgtcgtggagacgttcgcagacctgatggcgctggagcgcacccgtgagttcaag
ggccgctaccacgtcctgcacggcgttctgtctcccctggagggcgtgggccccgaccag
ctccgcatccgcgagctgctggagcgcctcaacgacagccgggtggaggaactcatcctc
gccaccaacccggacgtcgagggcgaagccaccgccctctacctgacccgcctgctcaag
cccatgggcctgcgtgtcacccgcatcgcccaggggctgcccatgggcggcgacctggag
ttcgccgaccaggccacgctcgccaaggcactctccgcccgccgcgacctctag

DBGET integrated database retrieval system