KEGG   Myxococcus xanthus: MXAN_2034Help
Entry
MXAN_2034         CDS       T00366                                 

Definition
(RefSeq) enoyl-CoA hydratase (EC:4.2.1.17)
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mxa  Myxococcus xanthus
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MXAN_2034
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MXAN_2034
   00650 Butanoate metabolism
    MXAN_2034
  Lipid metabolism
   00071 Fatty acid degradation
    MXAN_2034
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MXAN_2034
   00310 Lysine degradation
    MXAN_2034
   00360 Phenylalanine metabolism
    MXAN_2034
   00380 Tryptophan metabolism
    MXAN_2034
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MXAN_2034
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MXAN_2034
   00281 Geraniol degradation
    MXAN_2034
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MXAN_2034
   00627 Aminobenzoate degradation
    MXAN_2034
   00930 Caprolactam degradation
    MXAN_2034
Enzymes [BR:mxa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MXAN_2034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2365107..2365868
Genome map
AA seq 253 aa AA seqDB search
MSVRVEKNGLVTTVILDRPEVRNAVDGATAQALAEAFRAFDADPDARVGVLHGEGGTFCA
GADLKAVSEGRMPRLELDGDGPMGPSRMVLSKPVIASIGGHAVAGGLELALWCDLRVAEE
DAVLGVFCRRWGVPLIDGGTVRLPRLIGLSRALDLILTGRPVSAQEALAMGLVNRVVPRG
QAREAAEALAREVAAFPQACMNADRRSAYTQAGLGTEEALRQEFARGVKVLESESIAGAT
RFAQGAGRHGKFE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgcgcgtcgagaagaacggcctcgtcaccaccgtcatcctggaccgcccggag
gtgcgcaacgccgtggatggcgccaccgcccaggcgctggcggaggccttccgcgccttc
gacgcggacccggatgcgcgggtgggcgtgctccatggagaagggggtaccttctgcgcc
ggggcggacctgaaggccgtctccgagggccggatgccccgcctggagctggacggggat
ggacccatgggcccctcgcgcatggtgctgtccaagcccgtcatcgcgtccatcggcggc
catgccgtggcgggcggcttggagctggcgttgtggtgcgacttgcgcgtggccgaggag
gacgccgtcctgggcgtcttctgccgccgctggggtgtgcccctcatcgacggggggacg
gtgcggctgccccggctcattggcctttcgcgcgcgctggacctcatcctcacgggccgg
cctgtgtccgcccaggaggcgctggccatggggctggtcaaccgtgtggtgccccggggg
caggcgcgcgaggccgcggaggctctggcgcgcgaggtggccgccttcccgcaggcgtgc
atgaacgcggaccggcgctccgcctacacccaggcggggctgggcaccgaggaggcactg
cgtcaggagttcgcccgcggtgtcaaggtactggagtcggagtccattgctggcgccacg
cgttttgcccaaggggcggggcgtcacgggaagttcgaatag

DBGET integrated database retrieval system