KEGG   Myxococcus xanthus: MXAN_2034Help
Entry
MXAN_2034         CDS       T00366                                 

Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mxa  Myxococcus xanthus
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MXAN_2034
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MXAN_2034
   00650 Butanoate metabolism
    MXAN_2034
  Lipid metabolism
   00071 Fatty acid degradation
    MXAN_2034
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MXAN_2034
   00310 Lysine degradation
    MXAN_2034
   00360 Phenylalanine metabolism
    MXAN_2034
   00380 Tryptophan metabolism
    MXAN_2034
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MXAN_2034
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MXAN_2034
   00281 Geraniol degradation
    MXAN_2034
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MXAN_2034
   00627 Aminobenzoate degradation
    MXAN_2034
   00930 Caprolactam degradation
    MXAN_2034
Enzymes [BR:mxa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MXAN_2034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2365107..2365868
Genome map
AA seq 253 aa AA seqDB search
MSVRVEKNGLVTTVILDRPEVRNAVDGATAQALAEAFRAFDADPDARVGVLHGEGGTFCA
GADLKAVSEGRMPRLELDGDGPMGPSRMVLSKPVIASIGGHAVAGGLELALWCDLRVAEE
DAVLGVFCRRWGVPLIDGGTVRLPRLIGLSRALDLILTGRPVSAQEALAMGLVNRVVPRG
QAREAAEALAREVAAFPQACMNADRRSAYTQAGLGTEEALRQEFARGVKVLESESIAGAT
RFAQGAGRHGKFE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgcgcgtcgagaagaacggcctcgtcaccaccgtcatcctggaccgcccggag
gtgcgcaacgccgtggatggcgccaccgcccaggcgctggcggaggccttccgcgccttc
gacgcggacccggatgcgcgggtgggcgtgctccatggagaagggggtaccttctgcgcc
ggggcggacctgaaggccgtctccgagggccggatgccccgcctggagctggacggggat
ggacccatgggcccctcgcgcatggtgctgtccaagcccgtcatcgcgtccatcggcggc
catgccgtggcgggcggcttggagctggcgttgtggtgcgacttgcgcgtggccgaggag
gacgccgtcctgggcgtcttctgccgccgctggggtgtgcccctcatcgacggggggacg
gtgcggctgccccggctcattggcctttcgcgcgcgctggacctcatcctcacgggccgg
cctgtgtccgcccaggaggcgctggccatggggctggtcaaccgtgtggtgccccggggg
caggcgcgcgaggccgcggaggctctggcgcgcgaggtggccgccttcccgcaggcgtgc
atgaacgcggaccggcgctccgcctacacccaggcggggctgggcaccgaggaggcactg
cgtcaggagttcgcccgcggtgtcaaggtactggagtcggagtccattgctggcgccacg
cgttttgcccaaggggcggggcgtcacgggaagttcgaatag

DBGET integrated database retrieval system