KEGG   Myxococcus xanthus: MXAN_2252Help
Entry
MXAN_2252         CDS       T00366                                 

Definition
arginine kinase
Orthology
K00933  
creatine kinase [EC:2.7.3.2]
Organism
mxa  Myxococcus xanthus
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MXAN_2252
Enzymes [BR:mxa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     MXAN_2252
Exosome [BR:mxa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   MXAN_2252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2601650..2602675)
Genome map
AA seq 341 aa AA seqDB search
MLLHKHLTPELKSRLERLTTRNGWTLRKTIQSGLDHGDSQMGVYAGDSESYALFSPLLHP
IIRDHSGHDLSGHTSDFSLDGLPQGDLDPTGEFILSTRVRVGRNLARYAFPPAIGARDRA
ALEAEVVQVLSGLRGHLAGKYHPLASLSEAERLELVHHHVLFQQSDRFLDSAGVNRDWPR
NRGIFHSADMRFIVWVGEEDALRIISMQPGSGLAQTYLRLQTALEQFDGQLDFAQDSRLG
FLTACPTNLGTAMRASVLIRLPHLSRRPDFRARCARLGLAVRGLHGEHSEARDGIHDVSN
ATRLGVTERDIYEQLRTGIHALMEMESAARKRGHPKVAPGN
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgctgctccacaagcacctcacccccgagctgaaatcccggctcgaacggctcacgaca
cgcaacggctggacgctccggaagaccatccagagtggcctggaccacggagactcccag
atgggtgtctacgcgggtgacagcgagtcctacgcgctcttctccccgctgctgcatccc
atcatccgggaccattcgggccatgacctgagcggacacacgagtgacttctcactcgac
gggctgccccagggcgacctggaccccacgggcgagttcatcctctccacgcgggtccgc
gtcggacggaacctggcccggtatgcctttcctccggccattggcgccagggacagggcc
gcgctggaagccgaggtcgtccaggtcctctccggcctgaggggccacctcgcgggcaaa
taccatcccctggccagcctctccgaggcggagcggctggagctggtgcaccaccacgtc
ctgttccagcagtcggaccgcttcctggacagcgcgggcgtcaaccgcgactggcctcgc
aaccgcggcatcttccactccgcggacatgcgcttcatcgtctgggtcggggaggaagac
gccctgcgcatcatcagcatgcagcccggctcggggctggcgcagacctacctccggctc
cagacggcgctcgagcagttcgacgggcagctcgacttcgcccaggactcacggctgggc
ttcctcacggcgtgccccaccaacctgggcaccgccatgcgagcctccgtcctcatccgc
ctgccccacttgtcacggcggccggacttccgcgcgcggtgtgcccgcctggggctcgcg
gtgcgggggctgcacggcgaacactccgaagcccgggacggcatccatgatgtctccaat
gccacccgtctgggcgtcaccgagcgggacatctacgaacagcttcggacgggcatccac
gcgctcatggagatggaatccgcggcacgaaagcgcggacacccgaaggtggcgcccggg
aactga

DBGET integrated database retrieval system