KEGG   Myxococcus xanthus: MXAN_2372Help
Entry
MXAN_2372         CDS       T00366                                 

Gene name
pfkB
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
mxa  Myxococcus xanthus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MXAN_2372 (pfkB)
   01230 Biosynthesis of amino acids
    MXAN_2372 (pfkB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MXAN_2372 (pfkB)
   00030 Pentose phosphate pathway
    MXAN_2372 (pfkB)
   00051 Fructose and mannose metabolism
    MXAN_2372 (pfkB)
   00052 Galactose metabolism
    MXAN_2372 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    MXAN_2372 (pfkB)
Enzymes [BR:mxa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MXAN_2372 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2759273..2760220
Genome map
AA seq 315 aa AA seqDB search
MPHIVTLTLNPTIDVATSVPEVTPEHKLRCGPVRRDPGGGGINVARVVRELGGEAIAVYT
RGGATGSQLEELLEEKGLLRRSVPLQDATRESFTVAEGTGAREYRFILPGPTLSEREWQR
CLDALEDVAVGATYIVASGSLAPGVPEDFYARVARLGKRLAVRVVVDTNGPPLRAALEEG
VFMAKPNRRELRDLSGASVEDFATQAAAARELVAQGRAEVLAVSMGADGALVTTRTAQFR
ATPPPVRTYSSVGAGDSFVAGMTLALARGQSTEDALRWGIASGTAALLTQGTDLCYRADV
ERLFTQVKAEPVSRP
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgccgcacatcgtcaccctgacgctcaacccgaccatcgacgtggctacgtccgtgccg
gaagtcacgccggagcacaagctgcgctgtggccccgtgcgcagggacccgggtgggggc
ggcatcaacgtggcgcgcgtggtgcgtgagctgggcggtgaggccatcgccgtctacacg
cggggcggggccaccgggagccagttggaggagctcctggaggagaagggcctgctgcgc
cgctccgtgccgttgcaggacgccacccgggagagcttcacggtggcggaaggcacgggc
gcgcgtgagtatcgcttcatcctgccagggcccacgctgtccgagcgcgagtggcagcgc
tgcctcgacgcactggaggacgtggccgtgggcgcgacctacatcgtcgccagcggcagc
ctggcgcccggcgtaccggaggacttctatgcccgtgtggcccggctggggaagcgcctg
gccgtgcgcgtggtggtggacaccaacggtccgccgctgcgggccgcgctggaagagggc
gtgttcatggccaagcccaaccgccgcgagctgcgggacctgagcggcgcgtcggtggaa
gacttcgccacccaggccgccgcggcgcgcgagctggtggcccagggccgcgccgaagtg
ctggcggtgtccatgggcgcggacggcgcgctggtgacgacgcgcaccgcccagttccgg
gcgacgccgcccccggtgcggacgtacagctcggtgggcgcgggggacagctttgtcgcg
gggatgacgcttgcgctcgcgcggggccagtccaccgaggacgcgctgcgctggggcatc
gcctccgggacggccgcgctgctcacccaggggacggacctgtgttaccgggcggacgtg
gagcggctcttcacccaggtgaaggcggagccggtgtcgcgtccgtag

DBGET integrated database retrieval system