KEGG   Myxococcus xanthus: MXAN_2817Help
Entry
MXAN_2817         CDS       T00366                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mxa  Myxococcus xanthus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MXAN_2817 (tpiA)
   01230 Biosynthesis of amino acids
    MXAN_2817 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MXAN_2817 (tpiA)
   00051 Fructose and mannose metabolism
    MXAN_2817 (tpiA)
   00562 Inositol phosphate metabolism
    MXAN_2817 (tpiA)
Enzymes [BR:mxa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MXAN_2817 (tpiA)
Exosome [BR:mxa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MXAN_2817 (tpiA)
  Exosomal proteins of bladder cancer cells
   MXAN_2817 (tpiA)
  Exosomal proteins of melanoma cells
   MXAN_2817 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3289371..3290141
Genome map
AA seq 256 aa AA seqDB search
MATARRRKIVAGNWKMNKSVPEALALVRDLRGQVASLGDTVEVVVAPPFVALQPLHVALE
GAPLALAAQNCHWESSGAFTGEISAPMLAELGCAYVIVGHSERRQLFGDTDEQVNKRAKA
VRAAGMTPIICVGETLAEREANQTLAVVERQVRGALEGFGAKEVAGFVLAYEPVWAIGTG
RNATAAQAQEVHAAIRGLVERLYDGETAGRVRIQYGGSVKPDNAAELLGQPDVDGALVGG
ASLKAGDFAAIVKAAT
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgcgcgtcgtcggaagatcgttgctggcaactggaagatgaacaagtcggta
ccggaggcgctggccctggtgcgcgacctgcgagggcaggtggcttccctgggggacacc
gtggaggtggtggtggcgccgccgttcgtggcgctgcagccgctgcatgtcgcgctggaa
ggcgcgccgctggcgctggcggcgcagaattgtcactgggagtcctcgggcgccttcacg
ggtgagatttccgcgccgatgctggccgagctggggtgcgcctacgtcatcgtggggcac
tccgagcgccggcagctcttcggggacacggacgagcaggtgaacaagcgggcgaaggcg
gtccgcgcggcggggatgacgcccatcatctgcgtgggcgagacactggccgagcgcgag
gcgaaccagacgctggcggtggtggagcgtcaggtgcgcggggcgctggagggcttcggg
gccaaggaggtggcgggtttcgtgctggcctacgagccggtgtgggccattgggacgggg
cgcaacgccacggcggcgcaggcgcaggaggtccacgcggcgatccgggggctggtcgag
cgcctgtatgacggggagacggccgggcgggtgcgcatccagtacggcggcagcgtgaag
ccggacaacgccgcggaattgctgggccagccggacgttgacggggcgcttgtcgggggc
gcgagcctgaaggcgggcgacttcgcggccatcgtcaaggcggccacttag

DBGET integrated database retrieval system