KEGG   Myxococcus xanthus: MXAN_2817Help
Entry
MXAN_2817         CDS       T00366                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mxa  Myxococcus xanthus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:mxa01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mxa01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mxa00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mxa00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:mxa00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
3289371..3290141
Genome map
AA seq 256 aa AA seqDB search
MATARRRKIVAGNWKMNKSVPEALALVRDLRGQVASLGDTVEVVVAPPFVALQPLHVALE
GAPLALAAQNCHWESSGAFTGEISAPMLAELGCAYVIVGHSERRQLFGDTDEQVNKRAKA
VRAAGMTPIICVGETLAEREANQTLAVVERQVRGALEGFGAKEVAGFVLAYEPVWAIGTG
RNATAAQAQEVHAAIRGLVERLYDGETAGRVRIQYGGSVKPDNAAELLGQPDVDGALVGG
ASLKAGDFAAIVKAAT
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgcgcgtcgtcggaagatcgttgctggcaactggaagatgaacaagtcggta
ccggaggcgctggccctggtgcgcgacctgcgagggcaggtggcttccctgggggacacc
gtggaggtggtggtggcgccgccgttcgtggcgctgcagccgctgcatgtcgcgctggaa
ggcgcgccgctggcgctggcggcgcagaattgtcactgggagtcctcgggcgccttcacg
ggtgagatttccgcgccgatgctggccgagctggggtgcgcctacgtcatcgtggggcac
tccgagcgccggcagctcttcggggacacggacgagcaggtgaacaagcgggcgaaggcg
gtccgcgcggcggggatgacgcccatcatctgcgtgggcgagacactggccgagcgcgag
gcgaaccagacgctggcggtggtggagcgtcaggtgcgcggggcgctggagggcttcggg
gccaaggaggtggcgggtttcgtgctggcctacgagccggtgtgggccattgggacgggg
cgcaacgccacggcggcgcaggcgcaggaggtccacgcggcgatccgggggctggtcgag
cgcctgtatgacggggagacggccgggcgggtgcgcatccagtacggcggcagcgtgaag
ccggacaacgccgcggaattgctgggccagccggacgttgacggggcgcttgtcgggggc
gcgagcctgaaggcgggcgacttcgcggccatcgtcaaggcggccacttag

DBGET integrated database retrieval system