KEGG   Myxococcus xanthus: MXAN_2955Help
Entry
MXAN_2955         CDS       T00366                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mxa  Myxococcus xanthus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MXAN_2955 (folE)
Enzymes [BR:mxa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     MXAN_2955 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3462992..3463549
Genome map
AA seq 185 aa AA seqDB search
MARAVADFLRAAGLNLQDVHLADTPTRVAEAWAAEFLDGYSRTPEQALGETFPAPPGSSG
ELVVVTDLRFHSMCPHHLLPLTGRAHVAYVPGKRVVGFGRLSSLVDCFAHRLILQEDMAR
EVARSLAQVLGSPATACIIEAEQACLRLRGDKQRDAVTHAEAYEGTLRRDGPLRRELWAR
LGARR
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgtgccgtggcggacttcctgcgcgccgccggtctgaacctccaggacgtccac
ctggcggacacccccacgcgcgtggccgaggcctgggcggccgagttcctcgacggctac
agccgcaccccggagcaggcgctgggggagacgttccccgcgccgccgggctcctcgggc
gagctggtggtggtgacggacctgcgcttccactccatgtgtccgcaccacctgctgccg
ctcaccgggcgggcccacgtggcctacgtgccgggcaagcgggtggtgggctttggccgg
ctgtcatcgctggtggactgcttcgcgcaccggctcatcctccaggaggacatggcgcgg
gaagtggcgcgttccctggcgcaggtgctgggcagccccgccactgcatgcatcatcgaa
gcggagcaggcgtgcctgcgcctgcgcggggacaagcagcgcgacgccgtcactcacgcg
gaggcctatgaaggcaccctgcggcgcgacggccccctgcgccgtgagctgtgggcccgg
ttgggggcccggcgatga

DBGET integrated database retrieval system