KEGG   Myxococcus xanthus: MXAN_3409Help
Entry
MXAN_3409         CDS       T00366                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mxa  Myxococcus xanthus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MXAN_3409 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MXAN_3409 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MXAN_3409 (thrC)
Enzymes [BR:mxa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MXAN_3409 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3961949..3963289
Genome map
AA seq 446 aa AA seqDB search
MSEESASDFRAEYACSEGCDFRASLMDVVYRCPRCGGLLEVAHDVKALRTVSAAEWKRRF
ETRFGSARLPDGSGVWGKREWAYPQLPAEDIVSLGEGRVPLKPLPRMAAELGLAALDLKE
CGVSPTGSFKDWGMTVLVSAVKHMRARGVPLRAVACASTGDTSAALSAYCAAAGIPAVVF
LPRDKVSLAQLVQPIANGARVLSLDTDFDGCMKLVQAVTADTGLYLANSMNSLRIEGQKM
VAVELCQDLGWEPPDWVVIPGGNLGNASALGKGFELMLSLGLITRRPRIAVAQAQKANPL
VRSFRGGFQELVPLQAEPTLASAIQIGNPVSFKRAVKVLKAFDGVVEDASESELANAAAR
ADREGTFTCPHTGVALAALEKLVAQGVIARGSRVAVVSTAHGLKFADFKVGYHRGSLAEV
TSQFANPPVELPATLDAVKGALADLG
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaggagtcggcttcggatttccgcgcggagtacgcgtgcagtgagggctgtgac
tttcgcgcctcgctgatggacgtggtgtaccggtgcccgcgctgcggcggcctgctggag
gtcgcgcacgacgtgaaggccctgcgcacggtctccgcggcggaatggaagcgccgtttc
gagacgcgcttcggctccgcgcgcctgccggatggctcgggcgtctggggcaagcgggag
tgggcgtatccgcagctcccggcggaggacatcgtctcgctcggcgagggccgcgtgccg
ctcaagccgttgccgcgcatggcggcggagctggggctggccgcgctggacttgaaggag
tgcggcgtctcgcccacgggcagcttcaaggactgggggatgacggtcctggtctccgcg
gtgaagcacatgcgtgcccggggcgttccgctgcgcgcggtggcgtgtgcctccacgggc
gacacgtccgcggcgctctcggcctactgcgcggcggcggggattccggcggtggtgttc
ctgccgcgcgacaaggtgtcgctcgcgcagctcgtgcagcccattgccaatggggcgcgg
gtgctgtcgctggacacggacttcgacggctgcatgaagctggtgcaggcggtgacggcg
gacacggggctgtacctggccaactcgatgaactcgctgcgcatcgaaggccagaagatg
gtcgccgtggagctctgccaggacctgggctgggagccgccggactgggtggtgattccc
ggcggcaacctgggcaacgccagcgccttgggcaagggcttcgagctgatgctgtcgctg
gggctcatcacccgccggccgcgcatcgccgtggctcaggcccagaaggccaacccgctg
gtgcgctcgttccggggcggcttccaggagctggtgcccctgcaggccgagcctaccctg
gcgtcggccatccagattggcaacccggtgtcattcaagcgcgcggtgaaggtgctcaag
gcgttcgacggcgtggtggaggacgccagcgagtccgagctggccaacgccgccgcgcgg
gcggaccgcgagggaaccttcacctgtccgcacacgggcgtggcgctggcggcgctggag
aagctggtggcgcagggcgtgattgcccggggctcgcgcgtggcggtggtgtccaccgcg
cacggcctgaagttcgccgacttcaaggtgggctaccaccgcggctcgctggcggaggtg
acgagccagttcgccaacccgcccgtggagctgcccgcgacgctggacgcggtgaagggc
gcgctggcggacctgggctga

DBGET integrated database retrieval system