KEGG   Myxococcus xanthus: MXAN_4016Help
Entry
MXAN_4016         CDS       T00366                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mxa  Myxococcus xanthus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MXAN_4016 (pfkA)
   01230 Biosynthesis of amino acids
    MXAN_4016 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MXAN_4016 (pfkA)
   00030 Pentose phosphate pathway
    MXAN_4016 (pfkA)
   00051 Fructose and mannose metabolism
    MXAN_4016 (pfkA)
   00052 Galactose metabolism
    MXAN_4016 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    MXAN_4016 (pfkA)
Enzymes [BR:mxa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MXAN_4016 (pfkA)
Protein phosphatases and associated proteins [BR:mxa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MXAN_4016 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
4919928..4921013
Genome map
AA seq 361 aa AA seqDB search
MRLGVLTGGGDCPGLNALIRGLVKRGTHEFGYEFVGIENGYMGLVEPGLAHPLTEEDTRG
ILPKGGTILGTSNKANPFSYATREDGHWVERDVSDQVLLRCEELGLDGLIAVGGDGTLSI
AHRLVEKGLKVVGCPKTIDNDLSGTDQTFGFDTARLIVTEALDRLHSTAEAHDRVMVVEI
MGRHAGFLTLESGIAGGADVILIPEIPYSVESVVEKIRRRSTRRRSFSIIAISEGAFPQG
GELAVLDTAEAIPGRGVVRLGGSGKALADLLARHIEAEIRVTVLGHLQRGGSPSAADRVL
ATRYGCKVLDLVSAGQWDHMVALRAGEIIAVPLSESRKERRVDPAGELVRFTKSMGISFG
D
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgagacttggagtcctgaccggcggtggcgactgccccggcctcaacgcactcattcgc
ggcctcgtgaagcgaggcacgcacgaattcggctacgagttcgtgggcatcgagaacggc
tacatggggctggtggagccagggctcgcccacccgctcaccgaggaggacacccgcggc
atcctccccaagggcggcaccatcctgggcacgtccaacaaggccaaccccttcagctac
gcgacccgtgaggatgggcactgggtggagcgggacgtgtccgatcaggtcctgctccgc
tgcgaggagctgggcctggacgggctcatcgccgtgggcggcgacgggacgctgtccatc
gcccaccggctcgtggagaaggggctcaaggtcgtcggctgtccgaagaccatcgacaac
gacctgtccgggacggatcagaccttcggcttcgacaccgcgcggctcatcgtcaccgag
gcgctcgaccgcctgcactccaccgccgaggcccacgaccgggtgatggtcgtggagatc
atgggccgccacgccggcttcctcaccctggagagcggcatcgccgggggcgcggacgtc
atcctgattccggagattccgtacagcgtggagtccgtggtggagaagatccgccgccgc
tccacccgccgtcgcagcttctccatcatcgccatctccgaaggcgcgttcccccagggc
ggcgagctggccgtgctggacacggcggaggccattcccggccggggcgtggtgcggctc
ggcggctcggggaaggcgctggcggacctgctggcccggcacatcgaggcggagattcgc
gtgacggtgctgggccacctccagcgcgggggcagccccagcgcggcggaccgggtactg
gccactcgctacggctgcaaggtgctggacctggtgagcgcgggccagtgggaccacatg
gtggccctgcgtgcgggcgaaatcatcgcggtccccttgagcgagtcgcgcaaggagcgc
cgcgtggatccggcgggtgagctggtgcgcttcaccaagagcatgggcatcagcttcggg
gactga

DBGET integrated database retrieval system