KEGG   Myxococcus xanthus: MXAN_4016Help
Entry
MXAN_4016         CDS       T00366                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase I
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
mxa  Myxococcus xanthus
Pathway
mxa00010  Glycolysis / Gluconeogenesis
mxa00030  Pentose phosphate pathway
mxa00051  Fructose and mannose metabolism
mxa00052  Galactose metabolism
mxa00680  Methane metabolism
mxa01100  Metabolic pathways
mxa01110  Biosynthesis of secondary metabolites
mxa01120  Microbial metabolism in diverse environments
mxa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MXAN_4016 (pfkA)
   00030 Pentose phosphate pathway
    MXAN_4016 (pfkA)
   00051 Fructose and mannose metabolism
    MXAN_4016 (pfkA)
   00052 Galactose metabolism
    MXAN_4016 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    MXAN_4016 (pfkA)
Enzymes [BR:mxa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MXAN_4016 (pfkA)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     MXAN_4016 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ABF89567
UniProt: Q1D577
Position
4919928..4921013
Genome map
AA seq 361 aa AA seqDB search
MRLGVLTGGGDCPGLNALIRGLVKRGTHEFGYEFVGIENGYMGLVEPGLAHPLTEEDTRG
ILPKGGTILGTSNKANPFSYATREDGHWVERDVSDQVLLRCEELGLDGLIAVGGDGTLSI
AHRLVEKGLKVVGCPKTIDNDLSGTDQTFGFDTARLIVTEALDRLHSTAEAHDRVMVVEI
MGRHAGFLTLESGIAGGADVILIPEIPYSVESVVEKIRRRSTRRRSFSIIAISEGAFPQG
GELAVLDTAEAIPGRGVVRLGGSGKALADLLARHIEAEIRVTVLGHLQRGGSPSAADRVL
ATRYGCKVLDLVSAGQWDHMVALRAGEIIAVPLSESRKERRVDPAGELVRFTKSMGISFG
D
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgagacttggagtcctgaccggcggtggcgactgccccggcctcaacgcactcattcgc
ggcctcgtgaagcgaggcacgcacgaattcggctacgagttcgtgggcatcgagaacggc
tacatggggctggtggagccagggctcgcccacccgctcaccgaggaggacacccgcggc
atcctccccaagggcggcaccatcctgggcacgtccaacaaggccaaccccttcagctac
gcgacccgtgaggatgggcactgggtggagcgggacgtgtccgatcaggtcctgctccgc
tgcgaggagctgggcctggacgggctcatcgccgtgggcggcgacgggacgctgtccatc
gcccaccggctcgtggagaaggggctcaaggtcgtcggctgtccgaagaccatcgacaac
gacctgtccgggacggatcagaccttcggcttcgacaccgcgcggctcatcgtcaccgag
gcgctcgaccgcctgcactccaccgccgaggcccacgaccgggtgatggtcgtggagatc
atgggccgccacgccggcttcctcaccctggagagcggcatcgccgggggcgcggacgtc
atcctgattccggagattccgtacagcgtggagtccgtggtggagaagatccgccgccgc
tccacccgccgtcgcagcttctccatcatcgccatctccgaaggcgcgttcccccagggc
ggcgagctggccgtgctggacacggcggaggccattcccggccggggcgtggtgcggctc
ggcggctcggggaaggcgctggcggacctgctggcccggcacatcgaggcggagattcgc
gtgacggtgctgggccacctccagcgcgggggcagccccagcgcggcggaccgggtactg
gccactcgctacggctgcaaggtgctggacctggtgagcgcgggccagtgggaccacatg
gtggccctgcgtgcgggcgaaatcatcgcggtccccttgagcgagtcgcgcaaggagcgc
cgcgtggatccggcgggtgagctggtgcgcttcaccaagagcatgggcatcagcttcggg
gactga

DBGET integrated database retrieval system