KEGG   Myxococcus xanthus: MXAN_4217Help
Entry
MXAN_4217         CDS       T00366                                 

Definition
alpha keto acid dehydrogenase complex, E2 component, dihydrolipoamide acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mxa  Myxococcus xanthus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MXAN_4217
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MXAN_4217
   00020 Citrate cycle (TCA cycle)
    MXAN_4217
   00620 Pyruvate metabolism
    MXAN_4217
Enzymes [BR:mxa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MXAN_4217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5176806..5178056)
Genome map
AA seq 416 aa AA seqDB search
MAIFEFKLPDLGEGVMEGELVKWHVKAGDSVKEDQVLAEVMTDKATVTVPAPKAGRVVKT
HGNEGDMAKVHQLLVTLEVEGAAPAQAGGHSEASAPAAAPVAGGHVGGAPASASKVLATP
VTRRMAREHGLDLASIAGTGPQGRVTKADVVAALEGGEKNVVAAPAEQKARPAAPAVSSG
AADERVPLRGLRKKIAEKMVRSKFTAPHFAFVEEVDATELVALRARLNAQLAAAGENIKL
NYLPFIIKATVAALKKFPHLNANFDEASQELVVRGEFNIGMAAATPDGLTVAVVKSADRL
TLAELARETARLGAAARDRKLKMEELTGGTFTISSLGQSGGLFATPIINHPEVGILGVHR
LKKRPAVVGDQVVVRDMMNLSLSCDHRVIDGSVAADFTYEIIKYLEKPDLLFLAMA
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcttcgaattcaagctccccgaccttggtgaaggcgtgatggagggtgagctg
gtgaagtggcacgtgaaggcaggggattccgtcaaggaagaccaggtgctcgccgaggtg
atgacggacaaggccaccgtcaccgttcccgctcccaaggcgggccgtgtcgtgaagacg
catggcaatgaaggcgacatggcgaaggtgcaccagctcctcgtcaccctggaggtggag
ggcgctgcgccggcgcaggccggtggtcattccgaggccagcgcgccagcggcggcgccc
gtggcgggtggccatgtcggtggtgcgcctgcctcggcgtccaaggtgctggccacgccg
gtgacgcggcggatggcgcgcgagcacgggctggacctggcgtcgattgccggcacgggg
ccacagggccgcgtgacgaaggcggatgtggtggcggcgctggagggtggcgagaagaac
gtcgtcgcggctccggccgagcagaaggcgcgtcccgcggctcctgccgtcagctcgggc
gcggcggacgagcgcgttccgcttcggggcctgcgcaagaagatcgcggagaagatggtg
cggtcgaagttcacggcgccgcacttcgcctttgtcgaggaagtggacgccacggagctg
gtggccctgcgcgcgcggctgaacgcgcagttggcggcggccggtgagaacatcaagctc
aactacctgccgttcatcatcaaggcgacggtggcggcgctgaagaagttcccgcacctg
aacgcgaacttcgacgaggcgtcgcaggagctggtggtccgcggcgagttcaacatcggc
atggcggcggcgacgccggacggcctcaccgtggcggtggtgaagagcgcggaccggctg
acgctggccgagctggcgcgtgagacggcccgcctgggcgccgccgcgcgtgaccgcaag
ctgaagatggaggagctgacgggcggcaccttcaccatcagctcgctggggcagagcggc
ggcctgttcgccacgcccatcatcaaccaccctgaagtgggcatcctgggcgtgcaccgc
ctgaagaagcgcccggcggtggtgggggaccaggtcgtcgtgcgcgacatgatgaacctg
tcgctgtcgtgcgaccaccgcgtcatcgacggctcggtggcggcggatttcacgtacgaa
atcatcaagtacctggagaagccggacctgctgttcctggccatggcgtga

DBGET integrated database retrieval system