KEGG   Myxococcus xanthus: MXAN_4229Help
Entry
MXAN_4229         CDS       T00366                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
mxa  Myxococcus xanthus
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mxa01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:mxa00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(5187669..5188982)
Genome map
AA seq 437 aa AA seqDB search
MTAFLASSTLRYRGPLSALAREDVRRLLDRATGSDARVALRVREIIARVRAEGDQALFEL
ARQFDRVELTALEVPREVCAAALAGLEPSVRDALARAARNIALAHAPQKPQWVEVETEPG
VLVGRRPDPLGRVGVYAPGGRAVYPSSVLMGVVPAKVAGVGEVIVCSPPGPDGLPHPSVL
AAASLAGADRVFSLGGAGAVAAMAHGTESVPRVDRIVGPGNAYVAEAKLQVVGAVAIEAP
AGPSEILVVADDTANPAAVAREMLAQAEHDPEAACVTLALGDALADAIAAEVERQAERAK
RWEIVTSALGSRGAVLTVASLEEAWPFVADFAPEHLLIATASPREDLGQVRNAGTVFLGE
RSSVAYGDYMTGSNHVLPTAGLARAYSGLNLLDFYRWTTYQRVAPTAAASLAEDVGRLAD
SEGLFAHADAARAWGRP
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgacggccttccttgcttcgtcgaccctgaggtaccgcggtcctctgtccgctcttgct
cgggaggacgtccggcgtctgctggaccgcgcgactggatccgatgcccgcgtcgcgctg
cgcgtgcgggagatcatcgcccgcgtgcgagcggaaggggaccaggcgctcttcgaactc
gcgcggcagttcgaccgcgtggagctgacggcgctggaggttccgcgagaggtctgtgcc
gcggcgctcgccggattggagccatcggtcagggacgcgctggcccgagcggcccgcaac
atcgccctggcgcacgcgccgcagaagccgcaatgggtggaggtcgaaaccgagcccggt
gtgctcgtgggccggcggccggatccgctgggccgcgtgggggtgtatgcaccgggaggc
cgcgcggtgtaccccagcagcgtactgatgggggtggtgcccgcgaaggtagcgggcgtg
ggcgaggtcatcgtgtgctcgccgccggggcccgatggattgccacaccccagcgtgctg
gcggcggcatctctggcgggcgcggaccgagtcttctcgctgggcggcgctggcgcggtg
gcggccatggcccatggcacggaaagcgtgccgcgcgtggaccgcatcgtggggccgggc
aatgcctatgtggccgaggccaagctgcaggtggtgggcgcggtggcgattgaagcaccc
gcgggccccagtgaaatcctggtcgtggccgacgacacggcgaaccctgccgcggtggcg
cgggagatgctggctcaggcggagcatgacccagaggcggcttgtgtcacgctggcgctg
ggggacgcgctggcggacgccatcgccgcggaggtggagcggcaggccgagcgcgcgaag
cggtgggagatcgtcacgtcggccctgggctctcgcggcgcggtgctgacggtggcgtcc
ctggaggaagcctggcccttcgtggcggactttgctccggagcatctgctcatcgccacc
gcgtcgccgcgggaggacctggggcaggtgcgcaacgcgggcaccgtcttcctgggtgag
cgctcgtcggtggcctacggcgattacatgaccggctccaaccacgtgttgcccacggcg
gggttggcgcgggcgtactcgggactcaacctgctcgacttctaccggtggaccacctac
cagcgcgtcgcgcccacggcggcggcgtctcttgcggaggacgtggggcggctggccgac
agtgaaggtctcttcgcgcacgcggacgccgcgcgcgcctgggggcggccatga

DBGET integrated database retrieval system