KEGG   Myxococcus xanthus: MXAN_4353Help
Entry
MXAN_4353         CDS       T00366                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
mxa  Myxococcus xanthus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mxa00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(5358712..5359587)
Genome map
AA seq 291 aa AA seqDB search
MAPAALTLGARRFEWGSRTYVMGVVNVTPDSFSDGGRHAGTDAAIAHGLALAESGADLLD
VGGESTRPGSLPVSADEELARVIPVIEGLRARTDVPLSVDTTKAAVAREALKAGAHLIND
ITGFSSDAGLSRVVAEAGAACCLMHIQGTPATMQQAPRYDDVVEDVLAFLEAAILRAESA
GIPRGRILLDPGIGFGKTFEHNLFLLRRLPELRVLGLPLLVGTSRKGFLGRLAGGKPASE
RLAATLGSVASMAALGGADVARVHDVTEARDALAVADAIRRCEDGGTFYAR
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
gtggcgccggcggcgttgacgctgggcgcccggcgcttcgagtggggctcccgcacctac
gtcatgggcgtggtgaacgtgacgccggacagcttctcggatggcgggcgccatgccggg
acggacgccgccatcgcccacgggttggccttggccgaatcgggggcggacctgctcgac
gtgggcggcgagtccacccggcccggctctctgccggtcagtgccgacgaggagctggcg
cgggtgattcccgtcatcgagggcctccgggcccggaccgatgtgcctctttccgtggac
accaccaaggccgcggtggcgcgcgaggcgttgaaggccggtgcgcacctcatcaatgac
atcaccggcttcagctctgatgccggcctgtcccgcgtggtggccgaggccggcgccgcc
tgctgcctgatgcacatccagggcaccccggccacgatgcagcaggcgccgcgctacgac
gacgtcgtcgaggacgtgctggctttcctggaggccgctatcctccgggccgagtcggcg
ggcatcccccgggggcgcatcctcctggacccgggcatcggcttcgggaagaccttcgag
cacaacctcttcctgctgcgccgcctcccggagctgcgcgtgctggggctaccgttgctg
gtgggtacgagccgcaagggcttcctcggccggttggcgggcggcaagcctgcctccgaa
cggctggcggcgacgttgggctcggtggcctccatggcggcgctgggcggggccgacgtg
gcccgcgtccatgacgtgaccgaggcccgggacgcgctggccgtcgcggacgccatccgg
cggtgcgaagacggaggaacgttctacgcccggtaa

DBGET integrated database retrieval system