KEGG   Myxococcus xanthus: MXAN_4431Help
Entry
MXAN_4431         CDS       T00366                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mxa  Myxococcus xanthus
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MXAN_4431
Enzymes [BR:mxa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     MXAN_4431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
5479665..5480702
Genome map
AA seq 345 aa AA seqDB search
MATHFDPSAAAQPDSGVFGLPHSPEEAHVILIPVPFEATTSYGGGTSEGPTAVLEASRQV
DLFDVETGRPYERGIAMLPEPQELRDWNTRAKERAQVVIEAGGIHSGEAALIQAAQDVNV
LCDQMNEHVYRTTKHWLDQGKRVAAVGGDHSISYGIIRAHAEKYPGLGVLHLDAHADLRV
AYEGFTWSHASIMYNVAERIPGVKTLVQVGLRDMSAEEYQYIADSNGRVHGFFDAVLQNK
RFDGVPWNRQVDEMVALLPKQVYLSFDIDGLDPVLCPHTGTPVPGGLSFAEAVALIAGVV
RSGRTIVGFDLTEVAPDPEGGEWDGNVGARLLYKMIGWMLKSQQA
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggctacccacttcgaccccagcgccgccgcccagccggactccggcgtgttcggcctc
ccccactccccggaagaggcgcacgtcatcctcatccccgttcccttcgaggccaccacc
agttacggcggtggcacgtccgaggggccaaccgccgtcctggaagccagccggcaggtc
gacctcttcgacgtggagacgggtcgtccctacgagcgtggcatcgccatgctccccgag
ccccaggagctgcgcgactggaacacccgcgccaaggagcgcgcccaggtcgtcatcgag
gccggtggcatccactccggcgaggccgcgctgattcaggccgcgcaggacgtgaatgtc
ctctgcgaccagatgaacgagcacgtctaccgcaccaccaagcactggttggaccagggc
aagcgcgtggccgcggtgggcggtgaccactccatctcctacggcatcatccgcgcgcac
gcggagaagtaccccggcctgggcgtgctgcacctggacgcgcacgccgacctgcgcgtg
gcctacgagggcttcacctggtcccacgcgtccatcatgtacaacgtcgcggagcgcatc
cccggcgtgaagacgctggtccaggtgggcctgcgcgacatgagcgcggaggagtaccag
tacatcgcggactccaacggccgcgtgcacggcttcttcgacgccgtcctccagaacaag
cgcttcgacggcgtgccctggaaccggcaggtggatgagatggtcgccctgctcccgaag
caggtctacctgtccttcgacatcgacgggctggaccccgtgctctgcccccacacgggc
accccggtgcccggcggactgtccttcgccgaggccgtggccctcatcgccggcgtggtc
cgctccgggcgcaccatcgtgggcttcgacctcaccgaggtggcccccgaccccgagggc
ggcgagtgggacggcaacgtcggcgcccggcttctgtacaagatgattggctggatgctg
aagtcgcagcaggcctga

DBGET integrated database retrieval system