KEGG   Myxococcus xanthus: MXAN_4745Help
Entry
MXAN_4745         CDS       T00366                                 

Gene name
leuS
Definition
leucyl-tRNA synthetase (EC:6.1.1.4)
Orthology
K01869  
leucyl-tRNA synthetase [EC:6.1.1.4]
Organism
mxa  Myxococcus xanthus
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    MXAN_4745 (leuS)
Enzymes [BR:mxa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.4  leucine---tRNA ligase
     MXAN_4745 (leuS)
Amino acid related enzymes [BR:mxa01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   MXAN_4745 (leuS)
Transfer RNA biogenesis [BR:mxa03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    MXAN_4745 (leuS)
 Prokaryotic Type
    MXAN_4745 (leuS)
Mitochondrial biogenesis [BR:mxa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    MXAN_4745 (leuS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(5943324..5945819)
Genome map
AA seq 831 aa AA seqDB search
MNERYEPQAIEGKWQTRWDDAGIFRAGSRPGAPKKYVLEMLPYPSGKMHMGHVRNYLLGD
VYARYFRMKGFDVLHPMGWDALGLPAENAAIKDGVHPAVRTAENIASFKKEIKSLGYCYD
WDREVNTSDPEYYRWNQWFFIQMLERGLVYRRFSKVNWCTGCHTVIANEQVKDGVCERCD
SPVVDKEMPEWAFRITRFSQELLDALDTLKEWPHRITAAQRNWIGRSDGAEADFRVQGHD
TALRVFTTRIDTIFGCTYVVLAPDHELVAQVTTPERRAEVEAFAKRMAAQSKTERLGEGT
EKEGVFTGAYAENPFTGQAVPIWIANFVLSDYGTGAVMSVPAHDERDFAFARKYSLPVKV
VIQPASGDKLPPGDKLEAAYTEYGVLEDSGAYTGQTSEQARQAMAALLEKDGKGKATVTY
RQKDWGFSRQRYWGTPIPIVYCEKCDPDRNGIPVPVAQLPVRLPEIDTQAVLTGKGEPPL
AKVASWVNTSCPKCGGPARREAETMDTFVDSCWYFARYLSPHYDAAPFDPKEAQRFLPVD
IYVGGPEHAVMHLLYFRFWTRVMKLLGLSPVDEPVKRLITQGIVNGPDGRKMSKRWGNVV
APASIVQKYGADTARAYVLFAGPPERDFDWSDEQVEGVYRFLKRVWALAATHQAAAAGAT
HDGPYEGKALEILRAAHKTLKRVGEAIERLSFNTAIAGIMEGLNALYALGTPETAAEKAA
MAEAVRLLAVVLTPFTPHIADEIAEAYGSKDFTVAQSWPEFDPALVVDDVIPYAVQVNGK
LRAEIRVAADAAEADVRAAAEADEKVQVALAGKTLRKFVFVPKRLVNFVAT
NT seq 2496 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagcgttacgagccgcaggcgattgaaggtaagtggcagacccgttgggacgac
gcgggcatcttccgggcaggcagccgccccggtgcacccaagaagtacgtgctcgagatg
ctgccgtaccccagcgggaagatgcacatggggcatgtccgcaactacctgctcggggac
gtgtacgcgcgttacttccggatgaagggcttcgacgtgctgcatcccatgggctgggat
gcgctcggcctgccggccgagaacgcggccatcaaggacggcgtgcacccggcggtgcgc
acggccgagaacatcgcgtccttcaagaaggaaatcaaaagcctgggctactgctacgac
tgggatcgcgaggtcaacaccagcgatcccgagtactaccgctggaatcagtggttcttc
atccagatgctggagcgtgggctcgtctatcgccgcttcagcaaggtgaactggtgtacg
ggctgccacaccgtcatcgccaacgagcaggtgaaggacggcgtctgcgagcgctgcgac
tcccccgtggtggacaaggagatgcccgagtgggcgttccgcatcacccggttctcgcag
gagttgctggacgcgctggacacgctcaaggagtggccccaccgcatcaccgccgcgcag
cggaactggattggccgttcggacggtgccgaggccgacttccgcgtgcaggggcacgac
accgcgctgcgcgtgttcaccacccgcatcgacaccatcttcggctgcacctacgtggtg
ctggcgccggaccacgagttggtggcccaggtgacgacgccggagcgccgcgcggaggtg
gaagccttcgccaagcgcatggccgcgcagtccaagacggagcgcctgggcgagggcacg
gagaaggagggcgtctttactggcgcctacgcggagaatcccttcaccggccaggcggtc
cccatctggatcgccaacttcgtgctgagcgactacggcaccggcgcggtgatgagcgtg
cccgcgcatgacgagcgcgacttcgccttcgcgcgcaagtacagcctgcctgtgaaggtc
gtcatccagcccgcgtccggtgacaagctcccgccgggtgacaagctggaggcggcctat
acggagtacggcgtgctggaggactcgggcgcctacacgggccagacatccgagcaggcg
cgtcaggccatggccgcgttgctggagaaggacggcaagggcaaggcgacggtgacgtac
cgccagaaggactggggcttcagccgccagcgctactggggcacgcccatccccatcgtc
tactgcgagaagtgcgacccggaccgcaatggcatcccggtgccggtggcgcagctgccc
gtgcgcctgccggagatcgacacccaggcggtgctcaccggcaagggtgagccgccgctg
gcgaaggtggcctcgtgggtgaacacctcgtgtccgaagtgcggcgggcctgcccggcgc
gaggcggagacgatggacaccttcgttgactcctgctggtacttcgcgcgctacctgtcg
ccgcactacgacgccgcgccgttcgacccgaaggaggcccagcgcttcctgcccgtggac
atctacgtgggggggcccgagcacgcggtgatgcacctgctctatttccgcttctggacg
cgggtgatgaagctgttggggctgagccccgtggatgagcccgtcaagcgcctcatcacc
cagggcatcgtcaacgggccggatggccggaagatgtccaagcgctggggcaacgtggtg
gcgcctgcctccatcgtccagaagtacggcgcggacacggcgcgggcctacgtgttgttc
gcgggcccgccagagcgggacttcgactggtccgatgagcaggtggagggcgtgtaccgc
ttcctcaagcgcgtctgggcgctggccgccacgcaccaggcggcggccgcgggtgccacc
catgacgggccctacgagggcaaggcgctggagatcctccgcgccgcccacaagacgctg
aagcgggtgggggaggccatcgagcgcctgtccttcaacacggccatcgccggcatcatg
gaaggcctcaacgcgctctacgcactggggacacctgaaacggccgcggagaaggccgcc
atggcggaggccgtgcggttgctggcggttgtgctcacgccgttcacgccgcacatcgcg
gacgaaatcgcggaggcctatggcagcaaggacttcaccgtcgcgcagtcctggccggag
ttcgatccggcgctggtggtggacgacgtcatcccctacgccgtgcaggtgaacggcaag
ctgcgcgcggagattcgcgtggcggcggacgcggcggaggcggatgttcgcgccgcggca
gaagcggacgaaaaggtccaggtggccctggcggggaagacgctgcgcaagttcgtcttc
gtccccaagcgcctcgtgaacttcgtcgcgacctga

DBGET integrated database retrieval system