KEGG   Myxococcus xanthus: MXAN_4837Help
Entry
MXAN_4837         CDS       T00366                                 

Gene name
celA
Definition
endoglucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mxa  Myxococcus xanthus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mxa00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(6052139..6053617)
Genome map
AA seq 492 aa AA seqDB search
MQPSNSAGSPFRRFTAPAALMLAAALTTACGPSEPPAPAEAEALGSRTDALTELVSNGTF
NGGTVSPWWSGPNTQSRVENARLRVDVGGGTANPWDALIGQDDIPLVNGRAYTLSFTASA
SVSTTVRVTVQLESAPYTAPLDRQITLDGTSRRFTFPFTSTLATQAGQVTFQMGGRATGF
SAFIDDISLTTEDGGGGGGPLSMTNGFYIDPNSNPANWVRANSGDSRAARIQSSVANNLA
ARWFAAWSGDITTAVSSFVSAADAADKLPVLVAYNIPGRDCGSHSGGGAGSPEAYRTWIS
SFAAAIGNRPAVVIIEPDAVAQLDCLANDAERQTRISLIRYATEQFRDRAPNTWAYLDAG
NALWINADTMAQRLENMGVRNVRGFALNVSNFYTTAQSASYAGSVNSSLSSRYGYTKPFV
VDTSRNGNGSNGEWCNPAGRKIGTTNQVGVGGAEMTLWIKVPGDSDGQCGVAPNTPAGTF
VPDVALRMIDGL
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
gtgcaacccagtaactccgccggttcgccgtttcgtcgcttcaccgctccggccgcgctg
atgctcgcggcggccctcacgactgcctgtggtccctcggagccacccgccccggcggag
gccgaggcgctcggcagtcgcaccgacgcgctgaccgagctcgtctccaatggcaccttc
aacggcggcaccgtgtcgccctggtggagcggccccaatacgcagtcccgcgtggagaac
gcccgcctgcgcgtggatgtggggggcgggacggccaacccctgggacgcgctgattggc
caggatgacattccgctggtgaatggccgggcgtacacgctgtccttcaccgcttctgct
tcagtgtcgacgacggtccgtgtgacggtgcagttggagagcgcgccgtacaccgcgccg
ctggaccggcagattacgttggacggcacgtcacggcgcttcacgttccccttcacgtcg
acgctggccacgcaggcaggacaggtcaccttccagatgggaggccgcgcgacggggttc
agcgcgttcatcgatgacatctcgctcaccacggaggacggcggcggaggcggcgggccg
ctgtcgatgacgaacggcttctacatcgacccgaactccaaccccgccaactgggtccgg
gccaacagcggggactcgcgcgctgcgcgcatccagtcctccgtcgcgaacaacctggcc
gcacgttggttcgccgcttggagcggagacatcaccacggcggtgtccagcttcgtctcg
gccgcggacgcggcggacaagctgccggtgctggtggcgtacaacatccctggccgggac
tgcggaagccactcgggcggaggcgcggggtcgccagaggcgtaccggacgtggatttcg
tccttcgccgccgccattggcaaccgtcccgccgtcgtcatcatcgagccggacgccgtc
gcccagctcgactgcctggcgaacgacgccgagcgtcagacgcgcatcagcctcattcgc
tacgccaccgagcagttccgggatcgcgcgccgaacacgtgggcctacctggacgcgggc
aacgccttgtggatcaacgcggacaccatggcccagcggctggagaacatgggcgtgcgc
aacgtgcgtggcttcgcgctcaacgtgtcgaacttctacaccaccgcgcagtcggcctcg
tacgcgggctccgtcaacagctcgctgagcagccggtacggctacaccaagcccttcgtg
gtggacaccagccgtaacggcaatggctccaacggtgagtggtgcaaccccgccggccgg
aagattggcacgacgaaccaggtgggcgtgggcggcgcggagatgaccctgtggatcaag
gtccccggggactccgatggccagtgcggcgtcgcgcccaacacacccgcaggcacgttc
gtgccggacgtggccctgcggatgattgacggcctctga

DBGET integrated database retrieval system