KEGG   Myxococcus xanthus: MXAN_4837Help
Entry
MXAN_4837         CDS       T00366                                 

Gene name
celA
Definition
endoglucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mxa  Myxococcus xanthus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MXAN_4837 (celA)
Enzymes [BR:mxa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     MXAN_4837 (celA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(6052139..6053617)
Genome map
AA seq 492 aa AA seqDB search
MQPSNSAGSPFRRFTAPAALMLAAALTTACGPSEPPAPAEAEALGSRTDALTELVSNGTF
NGGTVSPWWSGPNTQSRVENARLRVDVGGGTANPWDALIGQDDIPLVNGRAYTLSFTASA
SVSTTVRVTVQLESAPYTAPLDRQITLDGTSRRFTFPFTSTLATQAGQVTFQMGGRATGF
SAFIDDISLTTEDGGGGGGPLSMTNGFYIDPNSNPANWVRANSGDSRAARIQSSVANNLA
ARWFAAWSGDITTAVSSFVSAADAADKLPVLVAYNIPGRDCGSHSGGGAGSPEAYRTWIS
SFAAAIGNRPAVVIIEPDAVAQLDCLANDAERQTRISLIRYATEQFRDRAPNTWAYLDAG
NALWINADTMAQRLENMGVRNVRGFALNVSNFYTTAQSASYAGSVNSSLSSRYGYTKPFV
VDTSRNGNGSNGEWCNPAGRKIGTTNQVGVGGAEMTLWIKVPGDSDGQCGVAPNTPAGTF
VPDVALRMIDGL
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
gtgcaacccagtaactccgccggttcgccgtttcgtcgcttcaccgctccggccgcgctg
atgctcgcggcggccctcacgactgcctgtggtccctcggagccacccgccccggcggag
gccgaggcgctcggcagtcgcaccgacgcgctgaccgagctcgtctccaatggcaccttc
aacggcggcaccgtgtcgccctggtggagcggccccaatacgcagtcccgcgtggagaac
gcccgcctgcgcgtggatgtggggggcgggacggccaacccctgggacgcgctgattggc
caggatgacattccgctggtgaatggccgggcgtacacgctgtccttcaccgcttctgct
tcagtgtcgacgacggtccgtgtgacggtgcagttggagagcgcgccgtacaccgcgccg
ctggaccggcagattacgttggacggcacgtcacggcgcttcacgttccccttcacgtcg
acgctggccacgcaggcaggacaggtcaccttccagatgggaggccgcgcgacggggttc
agcgcgttcatcgatgacatctcgctcaccacggaggacggcggcggaggcggcgggccg
ctgtcgatgacgaacggcttctacatcgacccgaactccaaccccgccaactgggtccgg
gccaacagcggggactcgcgcgctgcgcgcatccagtcctccgtcgcgaacaacctggcc
gcacgttggttcgccgcttggagcggagacatcaccacggcggtgtccagcttcgtctcg
gccgcggacgcggcggacaagctgccggtgctggtggcgtacaacatccctggccgggac
tgcggaagccactcgggcggaggcgcggggtcgccagaggcgtaccggacgtggatttcg
tccttcgccgccgccattggcaaccgtcccgccgtcgtcatcatcgagccggacgccgtc
gcccagctcgactgcctggcgaacgacgccgagcgtcagacgcgcatcagcctcattcgc
tacgccaccgagcagttccgggatcgcgcgccgaacacgtgggcctacctggacgcgggc
aacgccttgtggatcaacgcggacaccatggcccagcggctggagaacatgggcgtgcgc
aacgtgcgtggcttcgcgctcaacgtgtcgaacttctacaccaccgcgcagtcggcctcg
tacgcgggctccgtcaacagctcgctgagcagccggtacggctacaccaagcccttcgtg
gtggacaccagccgtaacggcaatggctccaacggtgagtggtgcaaccccgccggccgg
aagattggcacgacgaaccaggtgggcgtgggcggcgcggagatgaccctgtggatcaag
gtccccggggactccgatggccagtgcggcgtcgcgcccaacacacccgcaggcacgttc
gtgccggacgtggccctgcggatgattgacggcctctga

  All links  
No link information was found.   
DBGET integrated database retrieval system