KEGG   Myxococcus xanthus: MXAN_5032Help
Entry
MXAN_5032         CDS       T00366                                 

Definition
HAE1 family efflux transporter
Orthology
K03296  
hydrophobic/amphiphilic exporter-1 (mainly G- bacteria), HAE1 family
Organism
mxa  Myxococcus xanthus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
6290207..6293353
Genome map
AA seq 1048 aa AA seqDB search
MFVDFFIRRPVFAIVCSILLTLVGLIAIPTLPIAQYPDLAPPQVTVTSTYVGASAEVVES
AVTIPLEQELNGVEGMRYITSTSSNDGTSQITITFEATRDIEVAAVDVQNRVSRAAARLP
SQVNQTGIVVNKASSQMLLTVGLFSEDNRYDAKFLSNYADVSLKDAIKRVPGVGDVRIFG
ERKFSMRLWLDPTELARRKLTPQDVTRALQEQNLQVAAGQIGQPPSTEDQPYQIAVRARG
RLVEPAEFGDIVLMRDTDGTSIRVKDVGRVELGAENYGSVLRFNGKTGVGLGIFQLPTAN
ALDVRDGVYAELERLSKQFPPGMQFQTGTDTTLAVRASINEVIKTLVEAIVLVILVIFLF
LHGWRSVLITAFTLPVSLIGTFAFVHLMGFSINTLTLFGLTLATGLVVDDAIVVIENIER
LMVERRLSPVQAAREGMKEVTGAVIAISVVLVAVFVPVALFPGTTGAIYRQFALTIAASV
ALSTFCALTLTPALSAKMLKHHEGPKWVFFRWVDTVLDGTKALYGRGLRKLLKHPVLVLL
AFLACIGGTALLFRAAPTGFIPDEDQGYLIISIQGPEGMSLAQTEKVLAEAEAVLQAQPE
VRAMFAIGGFSMMGSGPNMGTIFSSLTSWEERKGKDQSVAALVERLRAPLSRIGGARVMP
FQPPAIRGVGSVGGFQYIVEDIDGTSSLDDLAAATQMLVAKANEHEQLRGAFSTFNADTP
LLDVEVDRQKAKALGVPIEQVFGTMQVYMGSQYVNDFNYANRTYRVYVQAEQQFRDSPSD
IGAFYVRSDTGDMIPLESLVKVEPTVSAQVIRHYNLFRSAEINGQPAPDVSSGQALEAME
TLATQHLPQGMSAEWTGISLEQKESGGQTAIIFALGLLFVFLVLAAQYESFSLPLVIIFS
VPLAIMGALGLQLARGFANDVFCQVGLVMLVGLASKNAILIVEFAEQLREGGKSAIDAVV
EAAEVRLRPILMTSIAFLLGVVPLMTASGAGAASRNSLGTAVFGGMLVSTVVNFVFIPGL
YVLMQKLRGDAKRATGEDEAVPTPAASH
NT seq 3147 nt NT seq  +upstreamnt  +downstreamnt
atgttcgtcgatttcttcatccgtaggcccgtcttcgccatcgtctgctccatcctgctg
acgctggtggggctgattgccatccccacgctgcccatcgcccagtacccggacctggcg
ccgccacaagtcaccgtgacgagcacctacgtgggtgcgagcgccgaggtggtggagagc
gccgtcaccatcccgctggagcaggagctcaacggcgtggagggcatgcgctacatcacc
tccaccagcagcaacgacggcaccagccagatcaccatcaccttcgaggccacgcgcgac
atcgaggtggccgccgtcgacgtgcagaaccgcgtcagccgcgccgcggcgcgcctgccc
tcgcaggtgaaccagacgggcatcgtcgtcaacaaggcctccagccagatgctgctgacg
gtgggcctgttcagcgaggacaaccgctacgacgccaagttcctcagcaactacgccgac
gtgagcctgaaggacgccatcaagcgcgtgcccggcgtgggtgacgtccgcatcttcggc
gagcgcaagttctccatgcgcctgtggctggaccccacggagctggcgcggcgcaagctc
acgccccaggacgtgacgcgcgcgctccaggagcagaacctccaggtggccgcgggtcag
attggccagccgccgtccaccgaggaccagccctaccagatcgcggtgcgggcccggggc
cgactggtggagccggcggagttcggcgacatcgtcctgatgcgggacacggatggcacg
agcatccgggtgaaggacgtgggccgcgtggagctgggcgcggagaactacggctccgtc
ctgcgcttcaacggcaagacgggcgtgggcctgggcatcttccagttgcccaccgccaac
gcgctggacgtgcgcgacggcgtgtacgcggagctcgagcggctgtcgaagcagttcccg
cccggcatgcagttccagacgggcaccgacaccaccctggccgtccgcgcctccatcaac
gaggtcatcaaaacgctggtggaagccatcgtcctcgtcatcctcgtcatcttcctgttc
ctgcacggctggcgcagcgtgctcatcaccgccttcaccctccccgtctcactgattggc
accttcgccttcgtccacctgatgggcttctccatcaacaccctcaccctcttcggcctc
acgctggccacgggcctggtggtggacgacgccatcgtcgtcatcgagaacatcgagcgg
ttgatggtggagcggcgcctgtcccccgtacaggccgcgcgcgagggcatgaaggaggtg
accggcgcggtcatcgccatctccgtggtgctggtggcggtgtttgtcccggtggcgctc
ttcccgggcaccactggcgccatctaccggcagttcgcgctgaccatcgccgcctccgtg
gcgctgtccaccttctgcgccctcaccctcaccccggcgctcagcgcgaagatgctgaag
caccacgagggaccgaagtgggtcttcttccgctgggtggacacggtgctggacgggaca
aaggcgctctacggccggggcctgcgcaagctgctgaagcatccggtcctggtcctgctc
gccttcctggcgtgcatcggcggcacggcgctgctgttccgcgccgcgcccacgggcttc
atccccgacgaggaccagggctatctcatcatctccatccagggccccgagggcatgtcg
ctcgcccagacggagaaggtgctggcagaggcggaggccgtcctacaggcgcagcccgag
gtgcgcgccatgttcgccattggcggcttctccatgatgggcagcggccccaacatgggc
accatcttctcgtcgctgacgtcctgggaggagcgcaagggcaaggaccagtcggtggcc
gcgctggtggagcggctgcgtgccccgctgagccgcatcggcggagcgcgcgtgatgccc
ttccagccgcccgccatccgaggcgtcggcagcgtgggcggcttccagtacatcgtcgag
gacatcgacggcaccagctcgctggatgacctggccgcggccacgcagatgctggtggcg
aaggccaacgagcacgagcaactgcgcggtgccttcagcaccttcaacgcggacacgccg
ctgctcgacgtggaggtggaccggcagaaggcgaaggcgctcggcgtgccgattgagcag
gtgttcggcaccatgcaggtctacatgggcagccagtacgtcaacgacttcaactacgcc
aaccgcacctaccgggtgtacgtccaggcggagcagcaattccgcgacagcccgtcggac
atcggcgccttctacgtgcgcagcgacaccggggacatgattccgctggagtcgctggtg
aaggtggagcccaccgtgtccgcccaggtcatccgccactacaacctgttccgctcggcg
gagatcaacgggcagccggcgccggacgtgtcctccggacaggcgctggaggccatggaa
acgctggccacgcagcacctgcctcagggcatgagcgcggagtggacgggcatcagcctg
gaacagaaggagagcggcgggcagacggccatcatcttcgcgctgggtctgctgttcgtc
ttcctggtgctcgcggcgcagtacgagagcttcagcctgccgctggtcatcatcttctcc
gtgcccctggccatcatgggcgcgttggggctgcagttggcgcgcgggttcgccaacgac
gtgttctgccaggtgggactggtgatgctggtcggcctggccagcaagaacgccatcctc
atcgtggagttcgccgagcagctccgggagggcgggaagagcgccatcgacgcggtggtg
gaggcggcggaggtccgcctgcgccccatcctgatgacgtccatcgccttcctcctgggc
gtggtgccgctgatgacggcctccggcgccggcgcggcgtcccgcaactccctggggacg
gcggtgttcggcggcatgctggtgtccacggtggtgaacttcgtgttcatccccgggctc
tacgtgctgatgcagaagctccgcggcgacgcgaagcgggccaccggtgaggacgaagcg
gtgcccacgcccgccgcgtcccactga

DBGET integrated database retrieval system