KEGG   Myxococcus xanthus: MXAN_5165Help
Entry
MXAN_5165         CDS       T00366                                 

Definition
GMC oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
mxa  Myxococcus xanthus
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(6449749..6451371)
Genome map
AA seq 540 aa AA seqDB search
MAMDCDWLIIGSGFGGSVSALRLTEKGYRVMVLEKGRRFRAPDFPKTNWALKRWLWMPTL
GWRGLFEMSFFRHVTVLSGVGVGGGSLVYANTLPIPRDDFFQASTWGHLAAWKEELAPHY
TTARRMLGATPNPLRTVPDQVLQDVGTDLGRTDFQPTTVAVYFGEPGVTVKDPYFNGEGP
DRTGCTACGGCMLGCRFDAKNTLDKNYLHLAERRGLALHADTEVTWVRPLPDGGYEVEAL
QGARRFFRKKVRFTAKHVVFAGGVLGTLDLLLKLKASPDGLPRLSDRLGDGVRTNSEALV
GVVSGRKGQDLSRGIAIGSILHTDAQSHLEPVRYSAGSGFFRLLMAPQVSGATMLQRFVR
LVGLLVRHPLRFLKAWFVPDFARRTMILLYMRTLEGHLRMTRSRRLGLSTALQEGPAPSA
NMPEAFDLARRVADKLDGYPMTIVSETLLGIPTTAHILGGCCMGDSAETGVIDSRHRVFG
HEGLYVVDGSAISANPGVNPSLTITALAERAMTFIPAARTAPRDEVAVPAGPMSSGARTS
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atggccatggactgcgactggctcatcatcggctcggggttcgggggcagcgtcagcgcg
ctccggctgaccgagaagggctaccgcgtcatggtgctggagaaggggcggcgctttcgc
gccccggacttcccgaagacgaactgggcgctgaagcgctggctctggatgcccacgctg
gggtggcggggcctgttcgagatgtcgttcttccgccacgtcaccgttctgtcgggcgtg
ggcgtgggcggtggctcgctcgtatacgccaacacgctccccatcccccgggacgacttc
ttccaggcctccacgtggggccacctcgccgcgtggaaggaggagctggcgccgcactac
accaccgcgcggaggatgctgggcgccacgccgaatccactgcgcaccgtgccagaccag
gtgctccaggacgtgggcacggacctgggccgcaccgacttccagcccaccacggtggcc
gtgtacttcggcgagccgggcgtcaccgtgaaggacccatacttcaatggtgagggaccg
gaccggacgggctgtaccgcgtgtggcgggtgcatgctggggtgtcgcttcgatgccaag
aacacgctcgacaagaactacctccacctggcggagcggcgcggcctcgcgctgcacgcg
gacaccgaagtcacctgggtgcgaccgctgccagacgggggctacgaagtcgaagcgctt
caaggggcgcggcgcttcttccggaagaaggtgcggttcaccgcgaagcacgtcgtcttc
gcggggggcgtgctgggcaccctggacctgctgctcaagttgaaggcgagcccggacgga
ctgccgcgcctgtcggaccggctgggagacggcgtgcgcaccaactccgaggcgctcgtg
ggggtggtgagcggccgcaaggggcaggatttgtcacggggcatcgccatcggttccatc
ttgcataccgatgcccagtcccacctggagccggtgcgctactcggcgggctcgggcttc
ttccggttgttgatggcgccgcaggtgtccggggccacgatgctccagcgcttcgtgcgg
ctggtgggcctgctggtccggcatccgctgcgcttcctcaaggcgtggttcgtcccggac
ttcgctcggcggacgatgattctgctctacatgcgcaccctggaagggcacctgcgcatg
acgcgctcgcggaggctggggctgagcacggcgctccaggagggcccggcgccgagcgcc
aacatgccggaggcgttcgacctggcccggcgcgtggcggacaagctggatggctatccg
atgaccatcgtcagcgagaccctgctgggcattccgacgacggcgcacatcctgggcggc
tgctgcatgggggactcggcggagacgggcgtcatcgactcgcggcaccgcgtgtttggc
catgaggggttgtatgtggtggacggctccgccatctccgccaatccgggcgtcaatccg
tcgctcacgattacggcgctggccgagcgcgcgatgaccttcattcccgcggcccggacg
gcgccgcgggacgaggtggccgtgcccgcggggcccatgtcctcgggcgcccgcacgagc
tga

DBGET integrated database retrieval system