KEGG   Myxococcus xanthus: MXAN_5932Help
Entry
MXAN_5932         CDS       T00366                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mxa  Myxococcus xanthus
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mxa03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(7354353..7355225)
Genome map
AA seq 290 aa AA seqDB search
MPELPEVEIARRNLVRWFSDRRIVRAESENTRIFRGAERQQFDALTGRLESLVRRGKYLL
FAFEGGKGLMGHLGMTGKFVRRTEGQVAPYSRARFHLDDGHVIHFSDPRMFGRLEPAPAA
RLRELDAVRILGRDPLADGLTAGQLQQAVGSSRKELKVALMDQERISGLGNIHAAEALFR
AGLHPSRQPGSLTPDEWKRLVQAIRATIDFGLKEQEGEEPVYLEEGRSENPFQVYGRAGS
PCSQCGTRVESFTQGGRTTHFCPRCQPEDGRRSEAGAPAVDGAKARPGKR
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgccagagctacccgaagtcgaaatcgcgcggcgcaacctggtgcgctggttcagcgac
cggcgcatcgtgcgcgccgagtcggagaacacccgcatcttccgaggcgccgagcgccag
cagttcgacgcactcacgggccggttggagtcgctggtccgccggggcaagtacctgctc
ttcgctttcgagggcggtaaggggctgatggggcacctggggatgacgggcaagttcgtc
cgccgcaccgaggggcaggtggcgccctacagccgcgcccggttccatctggacgacggc
catgtcatccacttctccgatccacgaatgttcggccgcctggagccggcgcccgccgcg
cgcctgcgggagctggacgcggtgcgaatcctggggagggatccgctggcggatggcctc
accgcggggcagctccagcaggccgtgggctcctcccggaaggagctgaaggtggcgctg
atggaccaggagcgcatctctggcctgggcaacatccacgccgccgaggcgctcttccgc
gcgggccttcacccctcgcgccagcccggctccctgacgccggacgagtggaaacgcctg
gtccaggccatccgcgccaccatcgacttcggcctcaaggagcaggagggggaggagccg
gtgtacctggaggaggggcgctcggagaatccattccaggtgtacggccgcgcggggagc
ccatgctcccagtgtggcacccgggtcgagtccttcacccagggaggccgtaccacccac
ttctgtccccggtgccagccggaggacggacgccgaagtgaggcgggggcgccggccgtt
gacggcgcgaaggcccgccctggtaagcgttga

DBGET integrated database retrieval system