KEGG   Myxococcus xanthus: MXAN_5943Help
Entry
MXAN_5943         CDS       T00366                                 

Gene name
folA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mxa  Myxococcus xanthus
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mxa00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:mxa00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
7365215..7365694
Genome map
AA seq 159 aa AA seqDB search
MKLSAIVAMAANRVIGAGNQLPWRLPADLARFKRITMGHTLVMGRKTYESIGRPLPGRTF
IVVTRQRDFAPPGVQVAHSVDEALSLAKASGDSEVFIAGGADLYAQTMDRVQRIYLTHIA
RNFPGDTWFPDVDLSGWTCVEEQAHPDAEPPHTFLTYER
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtccgccatcgtcgccatggcggcgaaccgtgtcatcggcgcgggcaaccag
ctcccgtggcggctgcccgcggacctcgcgcgcttcaagcgcatcaccatgggccacacc
ctggtgatggggcgcaagacgtacgagtccatcggccgcccgctgccgggccgcaccttc
atcgtcgtcacccgccagcgtgacttcgcgcccccgggcgtccaggtggcgcactccgtg
gacgaagcgctctccctggcaaaggccagtggcgactcggaggtcttcatcgccggaggc
gcggacctctacgcccagacgatggaccgcgtgcagcgcatctacctcacgcacatcgcc
cggaacttccctggcgacacctggttccccgacgtggacctgtccggttggacatgcgtc
gaagagcaagcacatcccgacgccgagccaccccacaccttcctcacctacgagcgctga

DBGET integrated database retrieval system