KEGG   Myxococcus xanthus: MXAN_6027Help
Entry
MXAN_6027         CDS       T00366                                 

Definition
(GenBank) methyl-accepting chemotaxis protein
Organism
mxa  Myxococcus xanthus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(7457690..7459285)
Genome map
AA seq 531 aa AA seqDB search
MSLPQQSFASQLSQQFRQSLGLAPKFVLVTALISATAATLLTGVATRRLESDLADSYLGA
GRHVARGLAVAAEQGVAAGASALQPMLDASVGHSDLAYAFIQDSAGNVVAHTFPDGFPDA
LKEAVATAGAGSVLEADAGGVRLRAMDVVAPVAGGRLGSVHVGVSRDHIDELVSALRVRM
VGFAALLVALGVAVSALFGRSIVGPLKSLTEVAGHIVESGDLTRPIQVKSGDEVGRLASS
FSQMVDRLREVTLNLQQAAVALTQSTEHLNSSSTEQAQTISRQAAALQETQVTAQEIKQT
SMLAAQKAESVLSVAERADTLAKSGEASIELTMAGLNDIRVQVGEIAQKIVELGERTQQI
GGITQTVKDLADQSNMLALNAAIESVRSGEHGKGFGVVAREIRALADQSIEATTRVRELL
DDIANQVTLAVRITERGAERMESGLAQVRTSGQNLRELSSIVQDNAAAVRQIAAAVSQQN
VGINQITLAVNDLSKMMDETVARIGSTGEAATTLQIISEQLSSAVKSYRVE
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
gtgagcctcccgcaacaatccttcgcctcccagttgtcgcagcagttccgccagtcgctg
gggctggcgccgaagttcgtgctcgtcaccgcgctcatcagcgcgacggcggccaccctg
ctcaccggtgtcgccacgcggcggctggagagcgacctggcggacagctacctgggcgcg
gggcggcacgttgcccgcgggctggcggtggcggcggagcagggggtggcggcgggggcg
agcgcgctccagcccatgctggacgccagcgtgggccattcggacctggcttatgcattc
attcaagactcggccggcaacgtggtggcccacaccttcccggacggcttcccggacgcg
ctgaaggaggcggtcgccaccgcgggcgcgggctcggtgctggaagcggacgccgggggc
gtccgcctgcgcgccatggacgtggtggcgccggtggccggtggccgcctgggctcggtg
cacgtgggcgtgtcccgggaccacatcgacgaactggtgtccgcgctgcgcgtccggatg
gtgggcttcgcggcgctgctggtggccctgggcgtggcggtgtccgcgctgttcggccgc
agcatcgtcggcccgttgaagagtctgacggaggtggccggccacatcgtggagtccggc
gatttgacgcgccccatccaggtgaagagcggtgatgaggtgggccggctggccagctcc
ttctcgcagatggtggatcggctgcgcgaggtgacgctcaacctccagcaggcggcagtg
gcactcacccagtccaccgagcacctgaattcgtcgtccacggagcaggcgcagaccatc
tcccggcaggccgcggcgctgcaggagacgcaggtgacggcgcaggaaatcaagcagacc
tccatgctggccgcgcagaaggcggagagcgtgctgtcggtggccgagcgcgccgacacg
ctggccaagtccggcgaggcctccatcgagctcaccatggcggggctcaacgacatccgc
gtccaggtgggggagattgcccagaaaatcgtcgagctgggcgagcgcacgcagcagatt
ggtggcatcacccagacggtgaaggacctggcggaccagtccaacatgctggcgctcaac
gccgccatcgagtccgtccgctccggcgagcacggcaagggcttcggcgtggtggcgcgc
gaaatccgcgccctggcggaccagtccatcgaagccaccacgcgcgtgcgcgagctgctg
gacgacatcgccaaccaggtgacgttggcggtgcgaatcacggagcgcggcgccgagcgc
atggagtcgggcctggcccaggtgcgcaccagcgggcagaacctgcgcgagctgtcctcc
atcgtccaggacaacgccgccgccgtccggcagattgccgccgccgtcagccagcagaac
gtgggcatcaaccaaatcaccctggcggtgaatgacttgtccaagatgatggacgagacg
gtggctcgcatcggctccaccggcgaggccgccaccacgctgcaaatcatctccgagcag
ctctccagcgcggtgaagagctaccgcgtcgagtag

DBGET integrated database retrieval system