KEGG   Myxococcus xanthus: MXAN_6028Help
Entry
MXAN_6028         CDS       T00366                                 

Definition
protein-glutamate methylesterase CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
mxa  Myxococcus xanthus
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MXAN_6028
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    MXAN_6028
Enzymes [BR:mxa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     MXAN_6028
Two-component system [BR:mxa02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   MXAN_6028
Bacterial motility proteins [BR:mxa02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    MXAN_6028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(7459362..7460429)
Genome map
AA seq 355 aa AA seqDB search
MSVQRPIRVLVVDDSPTMANMLTALLTEEPRIEVVGRAGDGNRAVQLARLLRPDVITMDL
LLPGLDGPGAIAAIMSQSPARILVVSAVAEQRGVDLGFQAMSAGALELIGKPNVTNAEEL
RRWGKELAHSVCLMAEVPVISRRPRAATAPPPPTGARVDIFGVVASTGGPPALADVLSKL
PRSLPVPLLIAQHITVGFTQGMVRWLSQVTPLPVSIAKDGERLEPGRVYFPLDGHDLLVD
AAGLARLQPSQGGPCPSGDVMLTSLAAAFGRRSGGVVLTGMGEDGARGLLAIRRAGGVTF
SQDEASSVVFGMPRAALDVKATDQGVPLASMPELILQSCTFAPFRGGRPEGGPTR
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgtccagcgacccattcgggtcctcgtggtggacgattcgcccaccatggcgaac
atgctgacggccctcctcacggaggagccgcgcatcgaagtcgtgggccgtgcgggagac
ggcaaccgcgccgtgcagttggcgcgcctgctgcgccccgatgtcatcaccatggacctg
ctgctgcccggcctggatggaccgggggccatcgccgccatcatgtcccagtcccccgcg
cgcatcctcgtggtgagcgcggtcgcggagcagcgcggcgtggacctgggcttccaggcg
atgagcgccggcgcgctggagctcatcggcaagcccaacgtgacgaacgcggaggagctg
cgccgctggggcaaggagctggcgcactcggtgtgcctcatggcggaggtgcccgtcatc
tcccgccggccgcgtgcggctaccgcgccgccgccgcccactggcgcgcgggtggacatc
ttcggcgtggtggcctccacgggcgggccgcccgcgctggcggacgtgctgtccaagctg
cctcgctcgctgccggtgccgctgctcatcgcccagcacatcaccgtgggcttcacccag
ggcatggtgcgctggctgtcccaggtgacgccgctgccggtgtccatcgccaaggacggc
gagcggctggagccaggccgcgtgtacttcccgctggacgggcatgacctgctggtggac
gcggccgggctggcgcgcctgcagcccagccagggcggaccgtgccccagcggggatgtg
atgctgacgtcgctggccgccgcctttggccggcgcagcggcggggtggtgctcaccggc
atgggcgaggacggcgcgcgcggcctgctggccatccgcagggcgggcggcgtcaccttc
tcccaggacgaggcgtcgtcggtcgtcttcggcatgcctcgcgccgcgctggatgtgaag
gccaccgaccagggcgtgcctctggcctcgatgccggagctcatcctccagagctgtacc
ttcgcccccttccggggcggacgccccgagggaggacccacccggtga

DBGET integrated database retrieval system