KEGG   Myxococcus xanthus: MXAN_6036Help
Entry
MXAN_6036         CDS       T00366                                 

Gene name
sucB
Definition
(RefSeq) 2-oxoglutarate dehydrogenase E2 (EC:2.3.1.61)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mxa  Myxococcus xanthus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MXAN_6036 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MXAN_6036 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    MXAN_6036 (sucB)
Enzymes [BR:mxa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MXAN_6036 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7469696..7470892
Genome map
AA seq 398 aa AA seqDB search
MAVEIKVPPLGESITEAVVGKWNKKPGDAVTADEPLVVLETDKVTIDVPAPSAGSLSSIA
FKEGDKVRVGEVLGLLEAGAGAPAARPAAAPAPAAAPAPAAEVPAASDARSTPTARKVAE
ENRLDISQVKGSGAGGRVHKDDVLGQLNRPATPAAPAQPAGPRPNAAREERVRMTPLRKR
VAERLIQAQSTAAMLTTFNEVDMGEVMALRKKYNDKFQQKHGVKLGFMSFFIRASVEALK
AFPQINAEIDGEDVIFKHYYDIGVAVSGSRGLVVPVVRNADKQGLAELEKSVGELGTKAR
NDKLALADLQGGTFTITNGGIFGSMLSTPILNPPQTGILGMHNIVERPVARDGQVVIRPI
MYIALTYDHRLVDGREAVQFLVRVKECIEDPERLLLDV
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggccgttgaaatcaaagtgccccccctgggcgaatccatcaccgaagccgtcgtcggc
aagtggaacaagaagccgggtgacgccgtcaccgccgacgagccgctcgtcgtcctggag
accgacaaggtcaccatcgacgtgccggccccgtccgctggctcgctgtccagcatcgcc
ttcaaggagggcgacaaggtccgcgtgggcgaggtgctcggcctcctcgaggcaggcgcc
ggcgctcccgccgccaggcccgccgccgctccggctccggccgccgcgcccgctcccgcc
gccgaggtgcccgcggcgtccgacgcgcgctccacgcccaccgcgcgcaaggtggccgag
gagaaccggctggacatctcccaggtgaagggcagcggcgccggtggccgcgtgcacaag
gacgacgtgctgggtcagctcaaccgcccggccacgcccgccgccccggcgcagcccgcc
ggcccccgcccgaacgccgcccgcgaggagcgcgtgcggatgacgccgctgcgcaagcgc
gtggccgagcgcctcatccaggcccagtccaccgccgccatgctcaccaccttcaacgag
gtggacatgggcgaggtgatggccctgcgcaagaagtacaacgacaagttccagcagaag
cacggcgtgaagctcggcttcatgagcttcttcatccgtgcctccgtcgaggccctcaag
gccttcccgcaaatcaacgcggagattgacggtgaggacgtcatcttcaagcactactac
gacatcggcgtggccgtcagcggcagccgcggtctggtggtgccggtggtgcgcaacgcg
gacaagcagggcctggcggagctggagaagtccgtgggcgagctgggcaccaaggcgcgc
aatgacaagctggccctggccgacctccagggtggcaccttcaccatcaccaacggcggc
atcttcggctccatgctgtccacgcccatcctcaacccgccgcagacgggcatcctgggc
atgcacaacatcgtcgaacgccccgtggcccgcgacggccaggtcgtgattcggcccatc
atgtacatcgcgctcacctacgaccaccggctggtcgacggccgcgaggccgttcagttc
ctggtgcgcgtgaaggagtgcatcgaggacccggagcggctgctcctggacgtctga

DBGET integrated database retrieval system