KEGG   Myxococcus xanthus: MXAN_6036Help
Entry
MXAN_6036         CDS       T00366                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase E2 (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mxa  Myxococcus xanthus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MXAN_6036 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MXAN_6036 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    MXAN_6036 (sucB)
Enzymes [BR:mxa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MXAN_6036 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
7469696..7470892
Genome map
AA seq 398 aa AA seqDB search
MAVEIKVPPLGESITEAVVGKWNKKPGDAVTADEPLVVLETDKVTIDVPAPSAGSLSSIA
FKEGDKVRVGEVLGLLEAGAGAPAARPAAAPAPAAAPAPAAEVPAASDARSTPTARKVAE
ENRLDISQVKGSGAGGRVHKDDVLGQLNRPATPAAPAQPAGPRPNAAREERVRMTPLRKR
VAERLIQAQSTAAMLTTFNEVDMGEVMALRKKYNDKFQQKHGVKLGFMSFFIRASVEALK
AFPQINAEIDGEDVIFKHYYDIGVAVSGSRGLVVPVVRNADKQGLAELEKSVGELGTKAR
NDKLALADLQGGTFTITNGGIFGSMLSTPILNPPQTGILGMHNIVERPVARDGQVVIRPI
MYIALTYDHRLVDGREAVQFLVRVKECIEDPERLLLDV
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggccgttgaaatcaaagtgccccccctgggcgaatccatcaccgaagccgtcgtcggc
aagtggaacaagaagccgggtgacgccgtcaccgccgacgagccgctcgtcgtcctggag
accgacaaggtcaccatcgacgtgccggccccgtccgctggctcgctgtccagcatcgcc
ttcaaggagggcgacaaggtccgcgtgggcgaggtgctcggcctcctcgaggcaggcgcc
ggcgctcccgccgccaggcccgccgccgctccggctccggccgccgcgcccgctcccgcc
gccgaggtgcccgcggcgtccgacgcgcgctccacgcccaccgcgcgcaaggtggccgag
gagaaccggctggacatctcccaggtgaagggcagcggcgccggtggccgcgtgcacaag
gacgacgtgctgggtcagctcaaccgcccggccacgcccgccgccccggcgcagcccgcc
ggcccccgcccgaacgccgcccgcgaggagcgcgtgcggatgacgccgctgcgcaagcgc
gtggccgagcgcctcatccaggcccagtccaccgccgccatgctcaccaccttcaacgag
gtggacatgggcgaggtgatggccctgcgcaagaagtacaacgacaagttccagcagaag
cacggcgtgaagctcggcttcatgagcttcttcatccgtgcctccgtcgaggccctcaag
gccttcccgcaaatcaacgcggagattgacggtgaggacgtcatcttcaagcactactac
gacatcggcgtggccgtcagcggcagccgcggtctggtggtgccggtggtgcgcaacgcg
gacaagcagggcctggcggagctggagaagtccgtgggcgagctgggcaccaaggcgcgc
aatgacaagctggccctggccgacctccagggtggcaccttcaccatcaccaacggcggc
atcttcggctccatgctgtccacgcccatcctcaacccgccgcagacgggcatcctgggc
atgcacaacatcgtcgaacgccccgtggcccgcgacggccaggtcgtgattcggcccatc
atgtacatcgcgctcacctacgaccaccggctggtcgacggccgcgaggccgttcagttc
ctggtgcgcgtgaaggagtgcatcgaggacccggagcggctgctcctggacgtctga

DBGET integrated database retrieval system