KEGG   Myxococcus xanthus: MXAN_6036Help
Entry
MXAN_6036         CDS       T00366                                 

Gene name
sucB
Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mxa  Myxococcus xanthus
Pathway
mxa00020  Citrate cycle (TCA cycle)
mxa00310  Lysine degradation
mxa01100  Metabolic pathways
mxa01110  Biosynthesis of secondary metabolites
mxa01120  Microbial metabolism in diverse environments
mxa01130  Biosynthesis of antibiotics
mxa01200  Carbon metabolism
Module
mxa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mxa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MXAN_6036 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    MXAN_6036 (sucB)
Enzymes [BR:mxa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MXAN_6036 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ABF93126
UniProt: Q1CZK2
Position
7469696..7470892
Genome map
AA seq 398 aa AA seqDB search
MAVEIKVPPLGESITEAVVGKWNKKPGDAVTADEPLVVLETDKVTIDVPAPSAGSLSSIA
FKEGDKVRVGEVLGLLEAGAGAPAARPAAAPAPAAAPAPAAEVPAASDARSTPTARKVAE
ENRLDISQVKGSGAGGRVHKDDVLGQLNRPATPAAPAQPAGPRPNAAREERVRMTPLRKR
VAERLIQAQSTAAMLTTFNEVDMGEVMALRKKYNDKFQQKHGVKLGFMSFFIRASVEALK
AFPQINAEIDGEDVIFKHYYDIGVAVSGSRGLVVPVVRNADKQGLAELEKSVGELGTKAR
NDKLALADLQGGTFTITNGGIFGSMLSTPILNPPQTGILGMHNIVERPVARDGQVVIRPI
MYIALTYDHRLVDGREAVQFLVRVKECIEDPERLLLDV
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggccgttgaaatcaaagtgccccccctgggcgaatccatcaccgaagccgtcgtcggc
aagtggaacaagaagccgggtgacgccgtcaccgccgacgagccgctcgtcgtcctggag
accgacaaggtcaccatcgacgtgccggccccgtccgctggctcgctgtccagcatcgcc
ttcaaggagggcgacaaggtccgcgtgggcgaggtgctcggcctcctcgaggcaggcgcc
ggcgctcccgccgccaggcccgccgccgctccggctccggccgccgcgcccgctcccgcc
gccgaggtgcccgcggcgtccgacgcgcgctccacgcccaccgcgcgcaaggtggccgag
gagaaccggctggacatctcccaggtgaagggcagcggcgccggtggccgcgtgcacaag
gacgacgtgctgggtcagctcaaccgcccggccacgcccgccgccccggcgcagcccgcc
ggcccccgcccgaacgccgcccgcgaggagcgcgtgcggatgacgccgctgcgcaagcgc
gtggccgagcgcctcatccaggcccagtccaccgccgccatgctcaccaccttcaacgag
gtggacatgggcgaggtgatggccctgcgcaagaagtacaacgacaagttccagcagaag
cacggcgtgaagctcggcttcatgagcttcttcatccgtgcctccgtcgaggccctcaag
gccttcccgcaaatcaacgcggagattgacggtgaggacgtcatcttcaagcactactac
gacatcggcgtggccgtcagcggcagccgcggtctggtggtgccggtggtgcgcaacgcg
gacaagcagggcctggcggagctggagaagtccgtgggcgagctgggcaccaaggcgcgc
aatgacaagctggccctggccgacctccagggtggcaccttcaccatcaccaacggcggc
atcttcggctccatgctgtccacgcccatcctcaacccgccgcagacgggcatcctgggc
atgcacaacatcgtcgaacgccccgtggcccgcgacggccaggtcgtgattcggcccatc
atgtacatcgcgctcacctacgaccaccggctggtcgacggccgcgaggccgttcagttc
ctggtgcgcgtgaaggagtgcatcgaggacccggagcggctgctcctggacgtctga

DBGET integrated database retrieval system