KEGG   Myxococcus xanthus: MXAN_6065Help
Entry
MXAN_6065         CDS       T00366                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mxa  Myxococcus xanthus
Pathway
mxa00260  Glycine, serine and threonine metabolism
mxa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mxa01100  Metabolic pathways
mxa01110  Biosynthesis of secondary metabolites
mxa01130  Biosynthesis of antibiotics
mxa01230  Biosynthesis of amino acids
Module
mxa_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MXAN_6065 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MXAN_6065 (trpB)
Enzymes [BR:mxa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MXAN_6065 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABF92384
UniProt: Q1CZH3
Position
7504183..7505388
Genome map
AA seq 401 aa AA seqDB search
MTTETAAGRFGRYGGRYVPETLVPALQELEEAYATASADPAFGEEVARVLREYVGRPTTL
TPARRLTEAWGGANVWLKREDLAHTGAHKINNTVGQVLLAKRMGKKRIIAETGAGQHGVA
TATACALFGLPCEVYMGALDVERQALNVFRMRALGAVVRPVESGSRTLKDAMNEAMRTWV
SQVSDTHYVIGSAAGPHPYPTVVRDFQTVIGRELRTQAQAAFGGLPDAIIACVGGGSNAI
GVLHPFIGDASVRLVGVEAGGHGLDTKQHGASLTLGTEGVLHGSRSLVLQDEDGQIQEAH
SISAGLDYPGVGPELAHLAKTGRMEVRIATDDEALAAFYEVARLEGILPALETSHAFARG
RELARELGAGKHLVINCSGRGDKDVATISARGVPPPVGVKA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaccacggagactgccgccggccgcttcgggcgctacggcggacgctacgttccggag
acactggttcccgcgctgcaggagctggaagaggcctacgccacggcgagcgcggacccg
gccttcggcgaggaggtcgcccgcgtgctgcgcgagtacgtgggccgccccaccacgctg
acgcccgcccggcgcctcacggaggcctggggcggcgcgaatgtgtggctcaagcgcgag
gacctggcgcacaccggtgcgcacaaaatcaacaacaccgtgggtcaggtgctgctcgcc
aagcggatgggcaagaagcgcatcatcgcggagacgggcgcgggccagcacggcgtcgcc
accgccaccgcgtgcgcgctcttcggcctgccctgcgaggtgtacatgggcgcgctggac
gtggagcggcaggcgctcaacgtcttccgcatgcgcgcgctgggcgcggtggtacggccg
gtggagtccggctcgcgcacgctgaaggacgcgatgaacgaggccatgcgcacctgggtg
tcgcaggtgtcggacacgcactacgtcatcggcagcgcggcggggccgcatccgtatccg
acggtggtgcgtgacttccagaccgtcatcggccgcgagctgcggacgcaagcccaggcg
gcctttggcggcctgccggatgccatcatcgcgtgcgtcgggggcggctcgaatgccatt
ggcgtgctgcacccgttcattggcgacgccagcgtgcggctggtgggcgtggaggcggga
ggccacggcctggatacgaagcagcacggcgcttcgctgacgctggggacagagggcgtg
ctgcacggctcgcgctcgctggtgctccaggacgaggacggccagattcaggaggcgcac
agcatctccgcgggcctggactatcccggcgtgggcccggagctggcgcacctggcgaag
acgggccgcatggaggtccgcatcgccacggacgacgaggcgctggcggccttctacgag
gtggcgcgcctggaaggcatcctccccgcgctggagacgtcccacgccttcgcgcgcggc
cgggagctggcgcgtgagctgggggcgggcaagcacctggtcatcaattgctcgggccgc
ggagacaaggacgtggccacgatttccgcgcggggcgtgcctccgccggtgggggtgaag
gcatga

DBGET integrated database retrieval system