KEGG   Myxococcus xanthus: MXAN_6065Help
Entry
MXAN_6065         CDS       T00366                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mxa  Myxococcus xanthus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MXAN_6065 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MXAN_6065 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MXAN_6065 (trpB)
Enzymes [BR:mxa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MXAN_6065 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
7504183..7505388
Genome map
AA seq 401 aa AA seqDB search
MTTETAAGRFGRYGGRYVPETLVPALQELEEAYATASADPAFGEEVARVLREYVGRPTTL
TPARRLTEAWGGANVWLKREDLAHTGAHKINNTVGQVLLAKRMGKKRIIAETGAGQHGVA
TATACALFGLPCEVYMGALDVERQALNVFRMRALGAVVRPVESGSRTLKDAMNEAMRTWV
SQVSDTHYVIGSAAGPHPYPTVVRDFQTVIGRELRTQAQAAFGGLPDAIIACVGGGSNAI
GVLHPFIGDASVRLVGVEAGGHGLDTKQHGASLTLGTEGVLHGSRSLVLQDEDGQIQEAH
SISAGLDYPGVGPELAHLAKTGRMEVRIATDDEALAAFYEVARLEGILPALETSHAFARG
RELARELGAGKHLVINCSGRGDKDVATISARGVPPPVGVKA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaccacggagactgccgccggccgcttcgggcgctacggcggacgctacgttccggag
acactggttcccgcgctgcaggagctggaagaggcctacgccacggcgagcgcggacccg
gccttcggcgaggaggtcgcccgcgtgctgcgcgagtacgtgggccgccccaccacgctg
acgcccgcccggcgcctcacggaggcctggggcggcgcgaatgtgtggctcaagcgcgag
gacctggcgcacaccggtgcgcacaaaatcaacaacaccgtgggtcaggtgctgctcgcc
aagcggatgggcaagaagcgcatcatcgcggagacgggcgcgggccagcacggcgtcgcc
accgccaccgcgtgcgcgctcttcggcctgccctgcgaggtgtacatgggcgcgctggac
gtggagcggcaggcgctcaacgtcttccgcatgcgcgcgctgggcgcggtggtacggccg
gtggagtccggctcgcgcacgctgaaggacgcgatgaacgaggccatgcgcacctgggtg
tcgcaggtgtcggacacgcactacgtcatcggcagcgcggcggggccgcatccgtatccg
acggtggtgcgtgacttccagaccgtcatcggccgcgagctgcggacgcaagcccaggcg
gcctttggcggcctgccggatgccatcatcgcgtgcgtcgggggcggctcgaatgccatt
ggcgtgctgcacccgttcattggcgacgccagcgtgcggctggtgggcgtggaggcggga
ggccacggcctggatacgaagcagcacggcgcttcgctgacgctggggacagagggcgtg
ctgcacggctcgcgctcgctggtgctccaggacgaggacggccagattcaggaggcgcac
agcatctccgcgggcctggactatcccggcgtgggcccggagctggcgcacctggcgaag
acgggccgcatggaggtccgcatcgccacggacgacgaggcgctggcggccttctacgag
gtggcgcgcctggaaggcatcctccccgcgctggagacgtcccacgccttcgcgcgcggc
cgggagctggcgcgtgagctgggggcgggcaagcacctggtcatcaattgctcgggccgc
ggagacaaggacgtggccacgatttccgcgcggggcgtgcctccgccggtgggggtgaag
gcatga

DBGET integrated database retrieval system