KEGG   Myxococcus xanthus: MXAN_6066Help
Entry
MXAN_6066         CDS       T00366                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mxa  Myxococcus xanthus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MXAN_6066 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MXAN_6066 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MXAN_6066 (trpA)
Enzymes [BR:mxa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MXAN_6066 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7505385..7506176
Genome map
AA seq 263 aa AA seqDB search
MSGEIARTFAQAKARGEGVLVTYAMAGDPDLPRSVDVFAALVEGGADVLEIGVAFSDPIA
DGPVIQGAAERALKAGSTLKRVLDEVVPAVRKRCPQTPLVIMTYVNLIMAMGEARYAKLA
RERGVSGTILPDLPPEESASLRATFDAEGMDLIPLCAPTTPPARAQAIAKDGRGFVYCVS
VSGVTGMRAELPPDLSQRLDLVRKAATVPVVAGFGISTAEQARMLSAHADGVVVGSALVR
AAHTEGLEAAKALCADIKRGLRR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgagattgcacggactttcgcccaggcgaaggcacggggcgaaggcgtactg
gtgacctatgccatggcgggcgacccggacctgccccgttcggtggacgtgttcgccgcg
ctggtcgagggcggcgcggacgtgctggagattggcgtggcgttcagcgaccccatcgcc
gacggccccgtcatccagggcgcggcggagcgagcgctcaaggccggctccacgctcaag
cgcgtgctggacgaggtggtgccggcggtacgcaagcgatgtccccagacgccgctggtc
atcatgacgtacgtcaacctcatcatggccatgggcgaggcgcgttacgcgaagctcgca
cgcgagcgcggcgtgtctggaaccatcctccccgacctgccgcccgaggagagcgcgagc
ctgcgcgccacgttcgacgcggagggcatggacctgattcccctgtgcgcccccacgacg
cccccggcgcgggcgcaggccatcgcgaaggatggccgtggctttgtctattgcgtgtcc
gtgtcgggcgtgacgggcatgcgcgcggagctgccgccggacctttcacagcgattggat
ttggtgcgcaaggccgcgaccgtgcccgtggtggcaggctttggcatctccacggcggaa
caggcacgcatgctgtctgcccatgcggacggcgtcgtggtgggcagcgcgctggtgcgt
gccgcgcacaccgagggcctcgaggcggcgaaggcgctctgcgccgacatcaagcgcggg
ctgcgacgctga

DBGET integrated database retrieval system