KEGG   Myxococcus xanthus: MXAN_6066Help
Entry
MXAN_6066         CDS       T00366                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mxa  Myxococcus xanthus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mxa01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mxa00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:mxa00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
7505385..7506176
Genome map
AA seq 263 aa AA seqDB search
MSGEIARTFAQAKARGEGVLVTYAMAGDPDLPRSVDVFAALVEGGADVLEIGVAFSDPIA
DGPVIQGAAERALKAGSTLKRVLDEVVPAVRKRCPQTPLVIMTYVNLIMAMGEARYAKLA
RERGVSGTILPDLPPEESASLRATFDAEGMDLIPLCAPTTPPARAQAIAKDGRGFVYCVS
VSGVTGMRAELPPDLSQRLDLVRKAATVPVVAGFGISTAEQARMLSAHADGVVVGSALVR
AAHTEGLEAAKALCADIKRGLRR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgagattgcacggactttcgcccaggcgaaggcacggggcgaaggcgtactg
gtgacctatgccatggcgggcgacccggacctgccccgttcggtggacgtgttcgccgcg
ctggtcgagggcggcgcggacgtgctggagattggcgtggcgttcagcgaccccatcgcc
gacggccccgtcatccagggcgcggcggagcgagcgctcaaggccggctccacgctcaag
cgcgtgctggacgaggtggtgccggcggtacgcaagcgatgtccccagacgccgctggtc
atcatgacgtacgtcaacctcatcatggccatgggcgaggcgcgttacgcgaagctcgca
cgcgagcgcggcgtgtctggaaccatcctccccgacctgccgcccgaggagagcgcgagc
ctgcgcgccacgttcgacgcggagggcatggacctgattcccctgtgcgcccccacgacg
cccccggcgcgggcgcaggccatcgcgaaggatggccgtggctttgtctattgcgtgtcc
gtgtcgggcgtgacgggcatgcgcgcggagctgccgccggacctttcacagcgattggat
ttggtgcgcaaggccgcgaccgtgcccgtggtggcaggctttggcatctccacggcggaa
caggcacgcatgctgtctgcccatgcggacggcgtcgtggtgggcagcgcgctggtgcgt
gccgcgcacaccgagggcctcgaggcggcgaaggcgctctgcgccgacatcaagcgcggg
ctgcgacgctga

DBGET integrated database retrieval system